Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PCNA Monoclonal antibody

PCNA Monoclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 60097-1-Ig
Clone No. 10D10E11
Publications (241)
Reviews (5)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (3)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

10D10E11, Cyclin, proliferating cell nuclear antigen

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of HEK-293 cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HEK-293 using 60097-1-Ig

    HEK-293 cells were subjected to SDS PAGE followed by western blot with 60097-1-Ig (PCNA Antibody) at various dilution incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HeLa using 60097-1-Ig

    Western blot analysis of PCNA in various cell lines using Proteintech antibody 60097-1-Ig at a dilution of 1:10000 (exposed for 2 seconds) incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HEK-293 cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HEK-293 using 60097-1-Ig

    WB result of PCNA antibody (60097-1-Ig; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PCNA transfected HEK-293 cells.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    WB analysis of HepG2 using 60097-1-Ig

    HepG2 cells were subjected to SDS PAGE followed by western blot with 60097-1-Ig (PCNA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    IP experiment of HepG2 using 60097-1-Ig

    IP result of anti-PCNA (IP:60097-1-Ig, 4ug; Detection:60097-1-Ig 1:300) with HepG2 cells lysate 3000ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human gliomas tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human gliomas using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human liver cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human liver cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human placenta tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human placenta using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:16000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human gliomas tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human gliomas using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of mouse ovary tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of mouse ovary using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of mouse ovary tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of mouse ovary using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer using 60097-1-Ig(PCNA antibody) at dilution of 1:800 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer using 60097-1-Ig(PCNA antibody) at dilution of 1:800 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human tonsillitis tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human tonsillitis using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human tonsillitis tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human tonsillitis using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human breast cancer tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IHC staining of human breast cancer using 60097-1-Ig

    Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60097-1-Ig (PCNA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    IF Staining of HepG2 using 60097-1-Ig

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 60097-1-Ig (PCNA antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using PCNA Monoclonal antibody (60097-1-Ig)

    IF Staining of HepG2 using 60097-1-Ig

    Immunofluorescent analysis of (10% Formaldehyde ) fixed HepG2 cells using 60097-1-Ig(PCNA antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of mouse heart tissue using PCNA Monoclonal antibody (60097-1-Ig)

    IF Staining of mouse heart using 60097-1-Ig

    E14.5 FFPE mouse heart stained for Desmin (green, Cat. No CL488-16520) and PCNA (red, Cat. No 60097-1-Ig). Desmin was conjugated to CoraLite-488 fluorescent dye and stains cardiomyocytes (heart muscle cells). PCNA stains proliferating cells, which are numerous in the developing heart. In this image, the four chambers of the heart can be easily visualized. Image credit: @Immunofluorescence on Instagram.

"PCNA Antibodies" Comparison

View side-by-side comparison of PCNA antibodies from other vendors to find the one that best suits your research needs.
Able AI
Able AI
What's the best dilution for PCNA in ?

Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, HeLa cells, Jurkat cells, K-562 cells, C6 cells, ROS1728 cells, NIH/3T3 cells, 3T3-L1 cells, 4T1 cells, RAW 264.7 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman gliomas tissue, human breast cancer tissue, human liver cancer tissue, human placenta tissue, human tonsillitis tissue, mouse ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, mouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60097-1-Ig targets PCNA in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, rabbit, zebrafish, goat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7416

Product name: Recombinant human PCNA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 8-256 aa of BC000491

Sequence: QGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIE

Predict reactive species
Full Name proliferating cell nuclear antigen
Calculated Molecular Weight 29 kDa/31 kDa
Observed Molecular Weight 36-38 kDa
GenBank Accession NumberBC000491
Gene Symbol PCNA
Gene ID (NCBI) 5111
RRIDAB_2236728
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP12004
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proliferating Cell Nuclear Antigen, commonly known as PCNA, is a protein that acts as a processivity factor for DNA polymerase δ in eukaryotic cells. This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand. PCNA induces a robust stimulatory effect on the 3'-5' exonuclease and 3'-phosphodiesterase, but not apurinic-apyrimidinic (AP) endonuclease, APEX2 activities. It has to be loaded onto DNA in order to be able to stimulate APEX2. PCNA protein is highly conserved during evolution; the deduced amino acid sequences of rat and human differ by only 4 of 261 amino acids. PCNA has been used as loading control for proliferating cells. The calculated molecular weight of PCNA is 29 kDa, but modified PCNA is 36kDa (PMID: 1358458).

Protocols

Product Specific Protocols
IF protocol for PCNA antibody 60097-1-IgDownload protocol
IHC protocol for PCNA antibody 60097-1-IgDownload protocol
IP protocol for PCNA antibody 60097-1-IgDownload protocol
WB protocol for PCNA antibody 60097-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

PCNA Monoclonal antibody (10D10E11), catalog number 60097-1-Ig, has accumulated 241 citations across diverse high-impact journals including Science, Nature Communications, Nature Microbiology, Nature Biomedical Engineering, Cell Reports, Advanced Science, and FASEB Journal. Research fields span oncology (hepatocellular carcinoma, lung cancer, colorectal cancer), cell proliferation and DNA replication, cardiovascular disease, liver regeneration, wound healing, immunology/inflammation, reproductive biology, neurology, diabetes, fibrosis, ferroptosis, and stem cell biology.

SpeciesApplicationTitle

Science

Zonated mechanosensing by PIEZO1 controls liver regeneration.

Authors - Ying Zhang
rabbitIF

Nat Biomed Eng

4D-printed adaptive hydrogel tissue expanders for ear and breast reconstruction.

Authors - Di Wang
human,mouse,ratWB,IF

Nat Microbiol

Oxaloacetate sensing promotes innate immune antiviral defence against influenza virus infection.

Authors - Shouheng Jin
IF

Nat Commun

PRMT1-methylated MSX1 phase separates to control palate development

Authors - Li Meng
humanIF

Nat Commun

USP52 acts as a deubiquitinase and promotes histone chaperone ASF1A stabilization.

Authors - Shangda Yang
mouseWB

Nat Commun

Acute liver steatosis translationally controls the epigenetic regulator MIER1 to promote liver regeneration in a study with male mice

Authors - Yanhao Chen

Reviews

    5.0 out of 5
Add a review

5 verified customer reviews

What customers say

All five reviews rate this anti-PCNA antibody 5 stars. Reviewers used it primarily for Western blot (4 reviews) and immunofluorescence (1 review) across mouse embryonic stem cells, U2OS cells, and human primary fibroblasts. Typical dilutions ranged from 1:1000 to 1:10,000 for WB and 1:200 for IF, with overnight incubation at 4°C being the most common protocol. Users consistently reported specific, strong signals with minimal background. Overall, the antibody is well-regarded for its specificity and performance across multiple cell types and applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Julia (Verified Customer) (08-12-2024)

Really good, specific antibody! Incubated over night at 4C; 1:10000 dilution in 3% milk.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mouse embryonic stem cells
PCNA Antibody Western Blot validation (1:10000 dilution) in mouse embryonic stem cells (Cat no:60097-1-Ig)

Tsimafei (Verified Customer) (08-04-2024)

Excellent antibody. Membrane was incubated at 4C, ON

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: mESCs
PCNA Antibody Western Blot validation (1:10000 dilution) in mESCs (Cat no:60097-1-Ig)

Andrea (Verified Customer) (01-11-2023)

primary antibody were incubated at 4C, ON. Antibody provide a specific signal for mouse Pcna protein

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mESCs
PCNA Antibody Western Blot validation (1:5000 dilution) in mESCs (Cat no:60097-1-Ig)

Hasan (Verified Customer) (11-04-2022)

U2OS cells fixed with Methanol:Aceton (7:3), 20 min, 4 degrees. Blocked for 1h with 5% FBS in Triton-x 0.1% Stained with the anti-PCNA (60097-1-Ig) (1:200) O/N @4 degress

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: U2OS WT
PCNA Antibody Immunofluorescence validation (1:200 dilution) in U2OS WT (Cat no:60097-1-Ig)

Maria (Verified Customer) (08-07-2021)

PCNA in human primary fibroblasts in culture. Passage number 15-25. 15 ug of protein. 4-15% TGX gel. Blocking BSA 3% in PBST. Primary ab 1:1000 in BSA O/N 4ºC. Secondary ab 1:5000 HRP.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: human primary fibroblasts
PCNA Antibody Western Blot validation (1:1000 dilution) in human primary fibroblasts (Cat no:60097-1-Ig)
Loading...
||
New chat

Able™

正在加载,请稍候...