PCNP Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PCNP Recombinant monoclonal antibody (86075-1-RR)

• 

  WB analysis using 86075-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86075-1-RR (PCNP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon using 86075-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 86075-1-RR (PCNP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 86075-1-RR

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 86075-1-RR (PCNP antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 86075-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PCNP antibody (86075-1-RR, Clone: 250576B6 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 86075-1-RR

  Biolayer interferometry (BLl) kinetic assays of 86075-1-RR against Human PCNP were performed. The affinity constant is 1.41 nM.

PCNP Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 86075-1-RR

Clone No.250576B6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PEST proteolytic signal-containing nuclear protein, PEST-containing nuclear protein

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, Jurkat cells, Raji cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86075-1-RR targets PCNP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag30951

  Product name: Recombinant human PCNP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC013916

  Sequence: MADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKI

• Full Name: PEST proteolytic signal containing nuclear protein
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 24-28 kDa
• GenBank Accession Number: BC013916
• Gene Symbol: PCNP
• Gene ID (NCBI): 57092
• RRID: AB_3744602
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WW12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PEST-containing nuclear protein (PCNP), characterized by a PEST motif rich in proline (P), glutamic acid (E), serine (S), and threonine (T), is firstly identified by database mining. The PCNP protein with the PEST motif is highly subjected to ubiquitination. PCNP may act as a transcriptional factor, cell cycle regulatory protein and tumor regulating nuclear protein.(PMID: 35813472, PMID: 32548978, PMID: 31487123)