Use Able AI chat for product recommendations

CoraLite® Plus 647 Anti-Human PD-L1/CD274 Rabbit Recombinant Antibody

PD-L1/CD274 Uni-rAb® Recombinant Antibody for FC

Cat No. CL647-98062
Clone No.240721H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

CD274, PD-L1, 240721H8, B7 H1, B7-H1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inPHA treated human PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in 100 μl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98062 targets PD-L1/CD274 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1114

Product name: Recombinant human PD-L1/CD274 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 19-238 aa of BC074984

Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Predict reactive species
Full Name CD274 molecule
Calculated Molecular Weight 290 aa, 33 kDa
GenBank Accession NumberBC074984
Gene Symbol PD-L1
Gene ID (NCBI) 29126
RRIDAB_3748703
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NZQ7
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Programmed cell death ligand 1 (PD-L1, CD274, or B7-H1), is the first member of B7 family to be discovered. B7 family molecules are type I transmembrane proteins belonging to the immunoglobulin superfamily. In concert with their CD28 family receptors, the B7s are key regulators of the adaptive immune response. PD-L1 is suggested as a negative regulator of T and B cell, and plays important role in mediating tolerance of lymphocytes to self-antigens. It is also involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PD-1-independent manner.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 PD-L1/CD274 antibody CL647-98062Download protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Joe (Verified Customer) (04-14-2026)

THP1 cells were induced with 10ng/ml each of TNF-a and IFN-y, and harvested at 6h and 24h. The antibody gave very clear staining and showed a clear surface upregulation of PD-L1 over time following cytokine treatment.

  • Applications: Flow Cytometry
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: THP1
Loading...
||
New chat

Able

正在加载,请稍候...