Anti-Mouse PD-L2/CD273 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of mouse splenocytes using 98241-1-RR (same clone as 98241-1-PBS)

  1x10^6 untreated or GM-CSF-treated mouse splenocytes were surface stained with 0.25 ug Anti-Mouse PD-L2/CD273 Rabbit RecAb (98241-1-RR, Clone: 241728D8) and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with APC Anti-Mouse CD11c (N418) (APC-65130, Clone: N418). Cells were not fixed. This data was developed using the same antibody clone with 98241-1-PBS in a different storage buffer formulation.

PD-L2/CD273 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98241-1-PBS

Clone No.241728D8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Synonyms

PD-L2/B7-DC, 241728D8, B7dc, B7-DC, Btdc

---

Product Information

98241-1-PBS targets PD-L2/CD273 in FC applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1842

  Product name: Recombinant Mouse PD-L2/B7-DC protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 20-219 aa of NM_021396.2

  Sequence: LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR

• Full Name: programmed cell death 1 ligand 2
• Calculated Molecular Weight: 28kDa
• GenBank Accession Number: NM_021396.2
• Gene Symbol: Pdcd1lg2
• Gene ID (NCBI): 58205
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9WUL5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Programmed cell death ligand 2 (PD-L2, also known as CD273, or B7-DC), is one of the B7 family molecules which are type I transmembrane proteins belonging to the immunoglobulin superfamily. PD-L2 was identified both by its homology to PD-L1 and by analysis of genes differentially expressed in libraries generated from dendritic cells (DC) and activated macrophages (PMID: 14515254). PD-L2 is a second ligand for PD-1, a costimulatory molecule that plays an inhibitory role in regulating T cell activation in the periphery.