PDGFA Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDGFA Polyclonal antibody, PBS Only (26940-1-PBS)

• 

  WB analysis using 26940-1-AP (same clone as 26940-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26940-1-AP (PDGFA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26940-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26940-1-AP (same clone as 26940-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26940-1-AP (PDGFA antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26940-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26940-1-AP (same clone as 26940-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26940-1-AP (PDGFA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26940-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 26940-1-AP (same clone as 26940-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 26940-1-AP (PDGFA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 26940-1-PBS in a different storage buffer formulation.

PDGFA Polyclonal Antibody for WB, Indirect ELISA

Cat No. 26940-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

PDGF 1, PDGF A, PDGF AA, PDGF subunit A, PDGF1

---

Product Information

26940-1-PBS targets PDGFA in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25643

  Product name: Recombinant human PDGFA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 135-196 aa of BC146594

  Sequence: TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR

• Full Name: platelet-derived growth factor alpha polypeptide
• Calculated Molecular Weight: 196 aa, 22 kDa
• Observed Molecular Weight: 13-16 kDa
• GenBank Accession Number: BC146594
• Gene Symbol: PDGFA
• Gene ID (NCBI): 5154
• RRID: AB_3669576
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04085
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDGFA is a member of the platelet-derived growth factor family. Four members of this family are mitogenic factors for cells of mesenchymal origin, and they are characterized by a motif of eight cysteines. PDGFA plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, and chemotaxis. It is also required for normal lung alveolar septum formation during embryogenesis, development of the gastrointestinal tract, and spermatogenesis. PDGFA is also involved in oligodendrocyte development and the myelination process in the spinal cord and cerebellum. PDGF-A protein monomer is about 13-16 kDa, and PDGF-AA is a 28.5 kDa A chain homodimer.