CoraLite® Plus 488-conjugated PDS5A Monoclonal antibody

• 

  IF Staining of SMMC-7721 using CL488-67520

  Immunofluorescent analysis of (4% PFA) fixed SMMC-7721 cells using CoraLite® Plus 488 PDS5A antibody (CL488-67520, Clone: 1C8D4 ) at dilution of 1:200.

• Featured Product
• KD/KO Validated

PDS5A Monoclonal Antibody for IF/ICC

Cat No. CL488-67520

Clone No.1C8D4

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

IF/ICC

Synonyms

DKFZp686B19246, FLJ41012, KIAA0648, PDS5, PDS5A, PIG54, SCC 112

---

Tested Applications

• Positive IF/ICC detected in: SMMC-7721 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67520 targets PDS5A in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11525

  Product name: Recombinant human PDS5A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-378 aa of BC009650

  Sequence: VKERRAHARQCLLKNISIRREYIKQNPMATEKLLSLLPEYVVPYMIHLLAHDPDFTRSQDVDQLRDIKECLWFMLEVLMTKNENNSHAFMKKMAENIKLTRDAQSPDESKTNEKLYTVCDVALCVINSKSALCNADSPKDPVLPMKFFTQPEKDFCNDKSYISEETRVLLLTGKPKPAGVLGAVNKPLSATGRKPYVRSTGTETGSNINVNSELNPSTGNRSREQSSEAAETGVSENEENPVRIISVTPVKNIDPVKNKEINSDQATQGNISSDRGKKRTVTAAGAENIQQKTDEKVDESGPPAPSKPRRGRRPKSESQGNATKNDDLNKPINKGRKRAAVGQESPGGLEAGNAKAPKLQDLAKKAAPAERQIDLQR

• Full Name: PDS5, regulator of cohesion maintenance, homolog A (S. cerevisiae)
• Calculated Molecular Weight: 1297 aa, 147 kDa
• GenBank Accession Number: BC009650
• Gene Symbol: PDS5A
• Gene ID (NCBI): 23244
• RRID: AB_2919490
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q29RF7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.