CoraLite® Plus 488-conjugated PDS5B Recombinant monoclonal antibody

PDS5B Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-86088-2
Clone No.250461B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Androgen-induced proliferation inhibitor, Androgen-induced prostate proliferative shutoff-associated protein AS3, APRIN, AS3, CG008

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86088-2 targets PDS5B in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag27977

Product name: Recombinant human PDS5B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1139-1310 aa of NM_015032

Sequence: MSSAGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDKRDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESDEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKT

Predict reactive species
Full Name PDS5, regulator of cohesion maintenance, homolog B (S. cerevisiae)
Calculated Molecular Weight 165 aa
Observed Molecular Weight166 kDa
GenBank Accession NumberNM_015032
Gene Symbol PDS5B
Gene ID (NCBI) 23047
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NTI5
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PDS5B (PDS5 Cohesin Scc1-like Protein B) is a protein associated with sister chromatid cohesion and maintenance of chromosome structure. It plays a significant role in cell cycle regulation, DNA repair, and gene expression. PDS5B interacts with the cohesin complex to ensure the proper separation of sister chromatids during cell division. Additionally, PDS5B is crucial in DNA damage repair, particularly during homologous recombination, helping to maintain genomic stability. It also indirectly affects gene expression and chromatin structure by modulating the function of the cohesin complex. PDS5B is widely expressed during embryonic development and is highly expressed in the brain and testes in adulthood. Its dysfunction is associated with multiple diseases, including Cohesinopathies and Cornelia de Lange syndrome.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PDS5B antibody CL488-86088-2Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...