Use Able AI chat for product recommendations

CD31 Monoclonal antibody

CD31 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66065-2-Ig
Clone No. 3F8E2
Publications (137)
Reviews (2)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IF-P, ELISA

3F8E2, EndoCAM, GPIIA, GPIIA', PECA1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CD31 in ?

Tested Applications

Positive WB detected inhuman peripheral blood platelets, Jurkat cells, THP-1 cells
Positive IHC detected inhuman liver cancer tissue, human oesophagus cancer tissue, human liver tissue, human tonsillitis tissue, human pancreas tissue, human placenta tissue, human pancreas cancer tissue, human colon cancer tissue, human liver cancer tissue, human appendicitis tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman placenta tissue, human liver cancer tissue
Positive IF/ICC detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:5000-1:20000
Immunofluorescence (IF)-PIF-P : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66065-2-Ig targets CD31 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag19730

Product name: Recombinant human CD31 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 428-738 aa of BC022512

Sequence: EVRCESISGTLPISYQLLKTSKVLENSTKNSNDPAVFKDNPTEDVEYQCVADNCHSHAKMLSEVLRVKVIAPVDEVQISILSSKVVESGEDIVLQCAVNEGSGPITYKFYREKEGKPFYQMTSNATQAFWTKQKANKEQEGEYYCTAFNRANHASSVPRSKILTVRVILAPWKKGLIAVVIIGVIIALLIIAAKCYFLRKAKAKQMPVEMSRPAVPLLNSNNEKMSDPNMEANSHYGHNDDVGNHAMKPINDNKEPLNSDVQYTEVQVSSAESHKDLGKKDTETVYSEVRKAVPDAVESRYSRTEGSLDGT

Predict reactive species
Full Name platelet/endothelial cell adhesion molecule
Calculated Molecular Weight 83 kDa
Observed Molecular Weight120-130 kDa
GenBank Accession NumberBC022512
Gene Symbol CD31
Gene ID (NCBI) 5175
ENSEMBL Gene IDENSG00000261371
RRIDAB_2918476
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP16284
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Platelet endothelial cell adhesion molecule-1 (PECAM-1, CD31) is a member of the immunoglobulin gene superfamily of cell adhesion molecules. CD31 is a transmembrane glycoprotein that is highly expressed on the surface of the endothelium, making up a large portion of its intracellular junctions. PECAM-1 is also present on the surface of hematopoietic cells and immune cells including platelets, monocytes, neutrophils, natural killer cells, megakaryocytes and some types of T-cell (PMID: 9011572). As well as its role in cell-cell adhesion, PECAM-1 functions as a signaling receptor, and is involved in important physiological events such as nitric oxide production, regulation of T-cell immunity and tolerance, leukocyte transendothelial migration and inflammation and angiogenesis (PMID: 21183735; 20978210; 17872453; 20634489).

Protocols

Product Specific Protocols
IF protocol for CD31 antibody 66065-2-IgDownload protocol
IHC protocol for CD31 antibody 66065-2-IgDownload protocol
WB protocol for CD31 antibody 66065-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CD31 Monoclonal antibody (3F8E2), catalog number 66065-2-Ig, has accumulated 137 citations across diverse journals including Nature Communications, Cell, Cancer Cell, Advanced Science, Materials Today Bio, Journal of Nanobiotechnology, and International Journal of Molecular Sciences. The associated research fields encompass angiogenesis and vascular biology, cardiovascular diseases, oncology, diabetic complications, tissue engineering and biomaterials, neurology, immunology, fibrosis, and wound healing. Cited applications include IF, IHC, and WB.

SpeciesApplicationTitle

Cancer Cell

Conserved spatial subtypes and cellular neighborhoods of cancer-associated fibroblasts revealed by single-cell spatial multi-omics

Authors - Yunhe Liu
humanWB

Cell

ACSL4 and polyunsaturated lipids support metastatic extravasation and colonization

Authors - Yuqi Wang
humanIF

Nat Nanotechnol

Prevention of acute thrombosis with vascular endothelium antioxidative nanoscavenger.

Authors - Yixin Zhong
IF

Cancer Commun (Lond)

Targeting SPHK1 in macrophages remodels the tumor microenvironment and enhances anti-PD-1 immunotherapy efficacy in colorectal cancer liver metastasis.

Authors - Yizhi Zhan
IF

Bioact Mater

Throw out an oligopeptide to catch a protein: Deep learning and natural language processing-screened tripeptide PSP promotes Osteolectin-mediated vascularized bone regeneration

Authors - Yu Chen
humanIHC,IF

Nat Commun

3D triply periodic minimal surface gyroid hydrogel scaffolds for soft tissue engineering.

Authors - Xiaoxiao Han

Reviews

    5.0 out of 5
Add a review

2 verified customer reviews

What customers say

Both reviewers gave 5-star ratings. One user reported excellent performance in immunofluorescence on human iPSC-derived vascular organoids, using a 1:500 dilution with overnight incubation on PFA-fixed, Triton-X permeabilized tissue. The other user confirmed it is a good IF antibody with no unspecific staining observed. Overall, the antibody is well-regarded for immunofluorescence applications, showing strong specific signal and clean background.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Refik (Verified Customer) (12-07-2025)

Works well with overnight incubation of human iPSC-derived vascular specific organoids using concentration 1:500 for ICC of 5% PFA fixed and 0.1/1% triton-X permeabilized cells and tissues.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:500 for ICC for overnight incubation of 3D PFA fixed organoid tissue in 1xTBST with 5% donkey serum

Alessandro (Verified Customer) (12-09-2023)

good IF antibody. no unspecific staining

  • Applications: Immunofluorescence
Loading...
||
New chat

Able™

正在加载,请稍候...