CoraLite® Plus 488-conjugated PELO Recombinant monoclonal antibody

• 

  IF Staining of A549 using CL488-85743

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using CoraLite® Plus 488 PELO antibody (CL488-85743, Clone: 243137F4 ) at dilution of 1:200.

• 

  IF Staining of HeLa using CL488-85743

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite® Plus 488 PELO antibody (CL488-85743, Clone: 243137F4 ) at dilution of 1:200.

PELO Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-85743

Clone No.243137F4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

CGI 17, CGI-17, hPelota, PRO1770, Protein Dom34 homolog

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells, A549 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-85743 targets PELO in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag0873

  Product name: Recombinant human PELO protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 42-384 aa of BC005889

  Sequence: STIRKVQTESSTGSVGSNRVRTTLTLCVEAIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELEPNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAVVMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNCSQHDRALERFYEQVVQAIQRHIHFDVVKCILVASPGFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHASSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDDFYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISDELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLHVSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEE

• Full Name: pelota homolog (Drosophila)
• Calculated Molecular Weight: 43 kDa
• Observed Molecular Weight: 43-45 kDa
• GenBank Accession Number: BC005889
• Gene Symbol: PELO
• Gene ID (NCBI): 53918
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9BRX2
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

The Pelo gene was originally identified in a mutagenesis screen for spermatogenesis-specific genes of Drosophila melanogaster. The PELO is required for the meiotic division during the G2/M transition, and functions in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs [PMID:12556505]. It may participate in the machinery of protein synthesis or in the regulation of mRNA translation [PMID:9584085].