PELP1 Monoclonal antibody

PELP1 Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA
Cat No. 67050-1-Ig
Clone No.1B11E4

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (1)

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA

1B11E4, HMX3, MNAR, Modulator of non-genomic activity of estrogen receptor, Proline-, glutamic acid- and leucine-rich protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, T-47D cells, Jurkat cells, HEK-293 cells, MCF-7 cells
Positive IHC detected inhuman cervical cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive IF-Fro detected inmouse breast cancer
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:8000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67050-1-Ig targets PELP1 in WB, IHC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivitymouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25729

Product name: Recombinant human PELP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 39-338 aa of BC069058

Sequence: ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV

Predict reactive species
Full Name proline, glutamate and leucine rich protein 1
Calculated Molecular Weight 1130 aa, 120 kDa
Observed Molecular Weight 160 kDa
GenBank Accession NumberBC069058
Gene Symbol PELP1
Gene ID (NCBI) 27043
RRIDAB_2882363
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IZL8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PELP1 was first identified as a 160 kDa protein in a screen for Src homology 2 (SH2) domain-binding proteins. PELP1 is overexpressed in 60-80% of breast tumors and plays important roles in both ER genomic and non-genomic signaling. In vivo, PELP1 subcellular localization is primarily nuclear in normal breast tissue, but it is localized to the cytoplasm in about 40% of invasive breast tumors. In the nucleus, PELP1 interacts with a number of transcription factors. The proto-oncogenic functions of PELP1 involve different cellular processes including epigenetic modifications leading to ER transactivation and breast cancer progression. Furthermore, PELP1 activates kinase cascades in the cytoplasm such as MAPK activation via c-Src and PI3K signaling.

Protocols

Product Specific Protocols
IF protocol for PELP1 antibody 67050-1-IgDownload protocol
IHC protocol for PELP1 antibody 67050-1-IgDownload protocol
WB protocol for PELP1 antibody 67050-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IHC,IF

Mol Biotechnol

MiR-153 is Involved in Testicular Ischemia/Reperfusion Injury by Directly Targeting FOXO3 and Regulating Spermatogonia Pyroptosis

Authors - Jinzhuo Ning
mouseWB,IHC

Int Immunopharmacol

MiR-195-5p is involved in testicular ischemia/reperfusion injury by directly targeting PELP1 and regulating spermatogonia pyroptosis

Authors - Kai-Xiang He

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

fatemeh (Verified Customer) (11-30-2021)

The antibody works well on human protein lystae (30 ug of protein from Hek293 cells, 8% gel, wet transfer 90min 300mA in tris-Gly buffer on PVDF, incubation with primary ab was onvernight at 4C). we coulnt see the specific band for mouse cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1-500
  • Cell Tissue Type: Hek293 (human), E14 (mouse)
PELP1 Antibody Western Blot validation (1-500 dilution) in Hek293 (human), E14 (mouse) (Cat no:67050-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...