PELP1 Monoclonal antibody, PBS Only

PELP1 Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, FC (Intra), Indirect ELISA
Cat No. 67050-1-PBS
Clone No.1B11E4

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF-P, IF-Fro, FC (Intra), Indirect ELISA

1B11E4, HMX3, MNAR, Modulator of non-genomic activity of estrogen receptor, Proline-, glutamic acid- and leucine-rich protein 1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67050-1-PBS targets PELP1 in WB, IHC, IF-P, IF-Fro, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag25729

Product name: Recombinant human PELP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 39-338 aa of BC069058

Sequence: ESVSGLLQPRTGSAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLCLLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFRDISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSPQLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNEGPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPV

Predict reactive species
Full Name proline, glutamate and leucine rich protein 1
Calculated Molecular Weight 1130 aa, 120 kDa
Observed Molecular Weight 160 kDa
GenBank Accession NumberBC069058
Gene Symbol PELP1
Gene ID (NCBI) 27043
RRIDAB_2882363
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ8IZL8
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PELP1 was first identified as a 160 kDa protein in a screen for Src homology 2 (SH2) domain-binding proteins. PELP1 is overexpressed in 60-80% of breast tumors and plays important roles in both ER genomic and non-genomic signaling. In vivo, PELP1 subcellular localization is primarily nuclear in normal breast tissue, but it is localized to the cytoplasm in about 40% of invasive breast tumors. In the nucleus, PELP1 interacts with a number of transcription factors. The proto-oncogenic functions of PELP1 involve different cellular processes including epigenetic modifications leading to ER transactivation and breast cancer progression. Furthermore, PELP1 activates kinase cascades in the cytoplasm such as MAPK activation via c-Src and PI3K signaling.

Loading...
||
New chat Able
正在加载,请稍候...