Use Able AI chat for product recommendations

PER2 (isoform 1) Monoclonal antibody

PER2 (isoform 1) Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67513-1-Ig
Clone No. 2E6C3
Publications (22)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, CoIP, ELISA
For FC, select conjugated version.

PER2, 2E6C3, FASPS, hPER2, PER 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PER2 (isoform 1) in ?

Tested Applications

Positive WB detected inHEK-293 cells, L02 cells, Y79 cells, BxPC-3 cells, K-562 cells, HL-60 cells, THP-1 cells
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67513-1-Ig targets PER2 (isoform 1) in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, pig
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29489

Product name: Recombinant human PER2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 740-839 aa of NM_022817

Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS

Predict reactive species
Full Name period homolog 2 (Drosophila)
Calculated Molecular Weight 137 kDa
Observed Molecular Weight150~160 kDa
GenBank Accession NumberNM_022817
Gene Symbol PER2
Gene ID (NCBI) 8864
RRIDAB_2882734
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO15055
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).

Protocols

Product Specific Protocols
IF protocol for PER2 (isoform 1) antibody 67513-1-IgDownload protocol
WB protocol for PER2 (isoform 1) antibody 67513-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The PER2 antibody (Cat# 67513-1-Ig) has 22 citations across journals including Phytomedicine, Cell Chem Biol, Free Radic Biol Med, Neuropsychopharmacology, FASEB J, J Biol Chem, Commun Biol, J Cell Sci, and CNS Neurosci Ther. Research fields span circadian biology, sleep disorders, lipid metabolism, cancer (hepatocellular, ovarian, esophageal), neuroscience, immunology, and ferroptosis, with applications primarily in WB, IF, IHC, and CoIP across mouse, human, pig, and rat species.

SpeciesApplicationTitle
mouse,humanWB

Phytomedicine

Ji-Ming-San enhances intestinal circadian rhythms and mitigates colitis in mice: The role of epithelial RORα

Authors - Zhixi Pan
WB

Sci Total Environ

Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario

Authors - Fangnon Firmin Fangninou
mouseIF

Cell Chem Biol

Lactylation of mTOR enhances autophagy in skeletal muscle during exercise.

Authors - Yan Li
mouseWB,IF

Free Radic Biol Med

BMAL1-mediated circadian-ferroptosis crosstalk drives neuronal vulnerability after TBI.

Authors - Ruoyu Huang
WB,CoIP

Neuropsychopharmacology

The crosstalk between CREB and PER2 mediates the transition between mania- and depression-like behavior

Authors - Xin-Ling Wang
humanWB

CNS Neurosci Ther

Cellular iron depletion enhances behavioral rhythm by limiting brain Per1 expression in mice

Authors - Qiong Wu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The antibody received a 5-star rating from a user who employed it for Western Blot at a 1:1000 dilution. The reviewer successfully used it on human keratinocytes, human cardiomyocytes, and mouse tissues including liver and skin, indicating reliable performance across multiple cell types and species.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Priya (Verified Customer) (01-05-2023)

I have been using this antibody for human keratinocytes, human cardiomyocytes and mouse tissues like liver and skin

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Cardiomyoctyes, Keratinocytes, Liver and skin
Loading...
||
New chat

Able™

正在加载,请稍候...