Tested Applications
| Positive WB detected in | HEK-293 cells, L02 cells, Y79 cells, BxPC-3 cells, K-562 cells, HL-60 cells, THP-1 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67513-1-Ig targets PER2 (isoform 1) in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, pig |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag29489 Product name: Recombinant human PER2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 740-839 aa of NM_022817 Sequence: SFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNTSGIDSPWKKTGKNRKLKSKRVKPRDSSESTGSGGPVSARPPLVGLNATAWSPSDTSQS Predict reactive species |
| Full Name | period homolog 2 (Drosophila) |
| Calculated Molecular Weight | 137 kDa |
| Observed Molecular Weight | 150~160 kDa |
| GenBank Accession Number | NM_022817 |
| Gene Symbol | PER2 |
| Gene ID (NCBI) | 8864 |
| RRID | AB_2882734 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O15055 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PER2, also named as KIAA0347, is a component of the circadian clock mechanism which is essential for generating circadian rhythms. Defects in PER2 are a cause of familial advanced sleep-phase syndrome (FASPS) which is characterized by very early sleep onset and offset. There are two isoforms of PER2: isoform 1 has an expected molecular size of about 140 kDa, and 67513-1-Ig detected molecular weight of 150-160 kDa (PMID:16675517), while isoform 2, known as PER2S (a second splicing variant of the human PER2 gene), has a molecular weight of about 45 kDa (PMID:26347774).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PER2 (isoform 1) antibody 67513-1-Ig | Download protocol |
| WB protocol for PER2 (isoform 1) antibody 67513-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PER2 antibody (Cat# 67513-1-Ig) has 22 citations across journals including Phytomedicine, Cell Chem Biol, Free Radic Biol Med, Neuropsychopharmacology, FASEB J, J Biol Chem, Commun Biol, J Cell Sci, and CNS Neurosci Ther. Research fields span circadian biology, sleep disorders, lipid metabolism, cancer (hepatocellular, ovarian, esophageal), neuroscience, immunology, and ferroptosis, with applications primarily in WB, IF, IHC, and CoIP across mouse, human, pig, and rat species.
| Species | Application | Title |
|---|---|---|
Phytomedicine Ji-Ming-San enhances intestinal circadian rhythms and mitigates colitis in mice: The role of epithelial RORα | ||
Sci Total Environ Metastatic effects of perfluorooctanoic acid (PFOA) on Drosophila melanogaster with metabolic reprogramming and dysrhythmia in a multigenerational exposure scenario | ||
Cell Chem Biol Lactylation of mTOR enhances autophagy in skeletal muscle during exercise. | ||
Free Radic Biol Med BMAL1-mediated circadian-ferroptosis crosstalk drives neuronal vulnerability after TBI. | ||
Neuropsychopharmacology The crosstalk between CREB and PER2 mediates the transition between mania- and depression-like behavior | ||
CNS Neurosci Ther Cellular iron depletion enhances behavioral rhythm by limiting brain Per1 expression in mice |
Reviews
What customers say
The antibody received a 5-star rating from a user who employed it for Western Blot at a 1:1000 dilution. The reviewer successfully used it on human keratinocytes, human cardiomyocytes, and mouse tissues including liver and skin, indicating reliable performance across multiple cell types and species.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Priya (Verified Customer) (01-05-2023) | I have been using this antibody for human keratinocytes, human cardiomyocytes and mouse tissues like liver and skin
|
