CXCL4/PF4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CXCL4/PF4 Polyclonal antibody, PBS Only (21157-1-PBS)

• 

  WB analysis of human peripheral blood platelets using 21157-1-AP (same clone as 21157-1-PBS)

  Human peripheral blood platelets were subjected to SDS PAGE followed by western blot with 21157-1-AP (PF4 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21157-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse spleen using 21157-1-AP (same clone as 21157-1-PBS)

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 21157-1-AP (PF4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21157-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse serum using 21157-1-AP (same clone as 21157-1-PBS)

  IP result of anti-CXCL4/PF4 (IP:21157-1-AP, 4ug; Detection:21157-1-AP 1:1000) with mouse serum lysate 2200 ug. This data was developed using the same antibody clone with 21157-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 21157-1-AP (same clone as 21157-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 21157-1-AP (CXCL4/PF4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 21157-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21157-1-AP (same clone as 21157-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using PF4 antibody (21157-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 21157-1-PBS in a different storage buffer formulation.

CXCL4/PF4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 21157-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, pig

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

CXCL4, PF4, SCYB4, C X C motif chemokine 4, C-X-C motif chemokine 4

---

Product Information

21157-1-PBS targets CXCL4/PF4 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12345

  Product name: Recombinant human PF4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-101 aa of BC093965

  Sequence: MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

• Full Name: platelet factor 4
• Calculated Molecular Weight: 101 aa, 11 kDa
• Observed Molecular Weight: 10 kDa
• GenBank Accession Number: BC093965
• Gene Symbol: PF4
• Gene ID (NCBI): 5196
• RRID: AB_2878819
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P02776
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The chemokine (C-X-C motif) ligand 4 (CXCL4) is also named as PF4 (Platelet factor-4) and SCYB4. The platelets, the most abundant source of CXCL4 in vivo, control profibrotic macrophage activation via CXCL4. (PMID: 36807143). Exogenous CXCL4 drove profibrotic activation of monocyte-derived dendritic cells in vitro (PMID: 33042127). Platelet factor-4 is a 70-amino acid protein that is released from the alpha-granules of activated platelets and binds with high affinity to heparin. Its major physiologic role appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation.