PFDN5 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PFDN5 Polyclonal antibody, PBS Only (15078-1-PBS)

• 

  WB analysis of HepG2 using 15078-1-AP (same clone as 15078-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15078-1-AP (PFDN5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15078-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 15078-1-AP (same clone as 15078-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 15078-1-AP (PFDN5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15078-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 15078-1-AP (same clone as 15078-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15078-1-AP (PFDN5 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15078-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15078-1-AP (same clone as 15078-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using PFDN5 antibody (15078-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red). This data was developed using the same antibody clone with 15078-1-PBS in a different storage buffer formulation.

PFDN5 Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 15078-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

PFD5, MM1, c-Myc-binding protein Mm-1

---

Product Information

15078-1-PBS targets PFDN5 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7150

  Product name: Recombinant human PFDN5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-154 aa of BC003373

  Sequence: MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

• Full Name: prefoldin subunit 5
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC003373
• Gene Symbol: PFDN5
• Gene ID (NCBI): 5204
• RRID: AB_2162703
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99471
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.