CoraLite® Plus 488-conjugated PFKM Recombinant monoclonal antibody

PFKM Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-84281-5
Clone No.241598B2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

241598B2, 6-phosphofructokinase type A, ATP-dependent 6-phosphofructokinase, muscle type, ATP-PFK, EC:2.7.1.11

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84281-5 targets PFKM in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag30840

Product name: Recombinant human PFKM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 675-725 aa of BC021203

Sequence: FATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVAE

Predict reactive species
Full Name phosphofructokinase, muscle
Observed Molecular Weight 75-85 kDa
GenBank Accession NumberBC021203
Gene Symbol PFKM
Gene ID (NCBI) 5213
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP08237
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PFKM, also named as GSD7, PFK-1, PFK-M and PFKX, belongs to the phosphofructokinase family and two domains subfamily. PFKM catalyzes the reaction: ATP + D-fructose 6-phosphate = ADP + D-fructose 1,6-bisphosphate. It is a key regulatory enzyme in glycolysis. Defects in PFKM cause glycogen storage disease type 7 (GSD7). PFKM has three isoforms with molecular weights of 85, 82, and 93 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PFKM antibody CL488-84281-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...