• Featured Product
  • KD/KO Validated

CoraLite® Plus 594-conjugated PGAM1 Monoclonal antibody

PGAM1 Monoclonal Antibody for IF/ICC
Cat No. CL594-67470
Clone No.2H2A9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat

Applications

IF/ICC

BPG dependent PGAM 1, PGAM B, PGAM1, PGAMA, Phosphoglycerate mutase 1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67470 targets PGAM1 in IF/ICC applications and shows reactivity with Human, Mouse, Rat samples.

Tested Reactivity Human, Mouse, Rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag9250

Product name: Recombinant human PGAM1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-254 aa of BC011678

Sequence: MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK

Predict reactive species
Full Name phosphoglycerate mutase 1 (brain)
Calculated Molecular Weight 254 aa, 29 kDa
Observed Molecular Weight 29 kDa
GenBank Accession NumberBC011678
Gene Symbol PGAM1
Gene ID (NCBI) 5223
RRIDAB_3084769
Conjugate CoraLite® Plus 594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths594 nm / 615 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP18669
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PGAM1(phosphoglycerate mutase 1) is also named as PGAMA,PGAM-B and belongs to the phosphoglycerate mutase family. Phosphoglycerate mutase is widely distributed in mammalian tissues where it catalyzes the reversible reaction of 3-phosphoglycerate (3-PGA) to 2-phosphoglycerate (2-PGA) in the glycolytic pathway. The homodimer PGAM1 is expressed mainly in liver, kidney, brain and overexpressed in a variety of human cancers, including breast carcinoma, colorectal cancer, lung cancer, prostate cancer, oral squamous cell carcinoma, esophageal squamous cell carcinomas and also associated with certain virus infection. PGAM1 could be developed as a useful diagnostic biomarker, as well as a potential therapeutic target for hepatocellular carcinoma (PMID:20403181). This antibody may also recognize PGAM2 and PGAM4 due to the high homology.

Protocols

Product Specific Protocols
IF protocol for CL Plus 594 PGAM1 antibody CL594-67470Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...