CoraLite® Plus 488-conjugated PGD Monoclonal antibody

PGD Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-67916
Clone No.2A10G4

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

IF/ICC, FC (Intra)

2A10G4, 6PGD, 6-phosphogluconate dehydrogenase, decarboxylating, EC:1.1.1.44, PGDH

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67916 targets PGD in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag6871

Product name: Recombinant human PGD protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 137-483 aa of BC000368

Sequence: YGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA

Predict reactive species
Full Name phosphogluconate dehydrogenase
Calculated Molecular Weight 53 kDa
Observed Molecular Weight 53 kDa, 45 kDa
GenBank Accession NumberBC000368
Gene Symbol PGD
Gene ID (NCBI) 5226
RRIDAB_2923824
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP52209
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PGD, also named as PGDH, belongs to the 6-phosphogluconate dehydrogenase family. PGD catalyses the oxidative decarboxylation of 6-phosphogluconate to ribulose 5-phosphate in the context of the oxidative part of the pentose phosphate pathway. PGD is important for the production of NADPH, which is necessary for reductive biosynthesis, such as the formation of lipids and nucleotides, and the activity of enzymes involved in maintaining cell integrity, in combatting oxidative stress and in the first line of immunological defence. (PMID: 35234135)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PGD antibody CL488-67916Download protocol
IF protocol for CL Plus 488 PGD antibody CL488-67916Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...