PHACTR4 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PHACTR4 Polyclonal antibody, PBS Only (13408-1-PBS)

• 

  WB analysis of mouse eye using 13408-1-AP (same clone as 13408-1-PBS)

  mouse eye tissue were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13408-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human liver using 13408-1-AP (same clone as 13408-1-PBS)

  human liver tissue were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13408-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A431 using 13408-1-AP (same clone as 13408-1-PBS)

  A431 cells were subjected to SDS PAGE followed by western blot with 13408-1-AP (PHACTR4 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13408-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 13408-1-AP (same clone as 13408-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 13408-1-AP (PHACTR4 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 13408-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 13408-1-AP (same clone as 13408-1-PBS)

  Immunofluorescent analysis of A431 cells using 13408-1-AP (PHACTR4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 13408-1-PBS in a different storage buffer formulation.

PHACTR4 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 13408-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PRO2963

---

Product Information

13408-1-PBS targets PHACTR4 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4054

  Product name: Recombinant human PHACTR4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 403-702 aa of BC029266

  Sequence: FGEPHIPSRLPPLPLHIRIQQALTSPLPMTPILEGSHRAHSLLFENSDSFSEDSSTLGRTRSLPITIEMLKVPDDEEEEEQTCPSTFSEEMTPTSVIPKLPQCLREEEEKESDSDSEGPIQYRDEEDEDESYQSALANKVKRKDTLAMKLNHRPSEPELNLNSWPCKSKEEWNEIRHQIGNTLIRRLSQRPTPEELEQRNILQPKNEADRQAEKREIKRRLTRKLSQRPTVAELLARKILRFNEYVEVTDAQDYDRRADKPWTKLTPADKAAIRKELNEFKSSEMEVHEESKHFTRYHRP

• Full Name: phosphatase and actin regulator 4
• Calculated Molecular Weight: 702 aa, 78 kDa
• Observed Molecular Weight: 71-78 kDa
• GenBank Accession Number: BC029266
• Gene Symbol: PHACTR4
• Gene ID (NCBI): 65979
• RRID: AB_10638316
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IZ21
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.