PHLPP1 Monoclonal antibody, PBS Only

PHLPP1 Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67640-1-PBS
Clone No.2E8E6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, Indirect ELISA

PLEKHE1, 2E8E6, EC:3.1.3.16, hSCOP, KIAA0606

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67640-1-PBS targets PHLPP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18982

Product name: Recombinant human PHLPP protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1068-1204 aa of BC126277

Sequence: QQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTP

Predict reactive species
Full Name PH domain and leucine rich repeat protein phosphatase
Calculated Molecular Weight 1717 aa, 184 kDa
Observed Molecular Weight 185 kDa
GenBank Accession NumberBC126277
Gene Symbol PHLPP
Gene ID (NCBI) 23239
RRIDAB_2882840
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO60346
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PHLPP (PH domain leucine-rich-repeats protein phosphatase) belongs to a novel family of Ser/Thr protein phosphatases that consists of PHLPP1 and PHLPP2 isoforms. It has been shown that PHLPP negatively regulates multiple oncogenic pathways by directly dephosphorylating and inactivating key signaling molecules, including Akt, S6K, and RAF1. Observed MW of PHLPP1 beta is 185 kDa.

Loading...
||
New chat Able
正在加载,请稍候...