PIH1D3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PIH1D3 Polyclonal antibody, PBS Only (25309-1-PBS)

• 

  IHC staining of human lung using 25309-1-AP (same clone as 25309-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 25309-1-AP (PIH1D3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25309-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 25309-1-AP (same clone as 25309-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 25309-1-AP (PIH1D3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 25309-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 25309-1-AP (same clone as 25309-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25309-1-AP (PIH1D3 antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 25309-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 25309-1-AP (same clone as 25309-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 25309-1-AP (PIH1D3 antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 25309-1-PBS in a different storage buffer formulation.

PIH1D3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 25309-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

25309-1-PBS targets PIH1D3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15039

  Product name: Recombinant human CXorf41 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-214 aa of BC033510

  Sequence: MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGAMGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQVGTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPELVECTSAKAFYIPETETLEITMTMKRELDIANFF

• Full Name: chromosome X open reading frame 41
• Calculated Molecular Weight: 214 aa, 24 kDa
• GenBank Accession Number: BC033510
• Gene Symbol: DNAAF6
• Gene ID (NCBI): 139212
• RRID: AB_2880024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NQM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.