• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PIN1 Recombinant monoclonal antibody

PIN1 Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-81857
Clone No.5N20

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

IF/ICC, FC (Intra)

Pin 1, Peptidyl-prolyl cis-trans isomerase Pin1, Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1, EC:5.2.1.8, 5N20

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-81857 targets PIN1 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0767

Product name: Recombinant human PIN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-163 aa of BC002899

Sequence: MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Predict reactive species
Full Name peptidylprolyl cis/trans isomerase, NIMA-interacting 1
Calculated Molecular Weight 18 kDa
Observed Molecular Weight18 kDa
GenBank Accession NumberBC002899
Gene Symbol PIN1
Gene ID (NCBI) 5300
RRIDAB_3084507
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13526
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PIN1(Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1) is essential for mitosis progression in yeast cells and is hypothesized to perform the same role in mammalian cells. It might regulate cellular processes distinct from the cell cycle itself, such as terminal differentiation through a modulation of differentiation-specific gene expression(PMID:20801874). It colocalizes with NEK6 in the nucleus. Pin1 inhibition simultaneously blocks multiple cancer pathways, disrupts the desmoplastic and immunosuppressive TME, and upregulates PD-L1 and ENT1, rendering pancreatic ductal adenocarcinoma (PDAC) eradicable by immunochemotherapy (PMID: 34388391).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PIN1 antibody CL488-81857Download protocol
FC protocol for CL Plus 488 PIN1 antibody CL488-81857Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...