PKN2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PKN2 Polyclonal antibody (14608-1-AP)

• Featured Product
• KD/KO Validated

PKN2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14608-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA

Synonyms

EC:2.7.11.13, Pak 2, PAK2, PKN gamma, PRK2

• 

  WB analysis of HEK-293 using 14608-1-AP

  WB result of PKN2 antibody (14608-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKN2 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 14608-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 14608-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 14608-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 14608-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of COLO 320 using 14608-1-AP

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SKOV-3 using 14608-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of COLO 320 using 14608-1-AP

  IP result of anti-PKN2 (IP:14608-1-AP, 4ug; Detection:14608-1-AP 1:1000) with COLO 320 cells lysate 2560 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 14608-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 14608-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14608-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14608-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14608-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PKN2 antibody (14608-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 14608-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PKN2 (14608-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PKN2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A2780 cells, K-562 cells, HeLa cells, HEK-293 cells, COLO 320 cells, SKOV-3 cells, HEK-293T cells
• Positive IP detected in: COLO 320 cells
• Positive IHC detected in: human colon cancer tissue, human lung cancer tissue, human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14608-1-AP targets PKN2 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6164

  Product name: Recombinant human PKN2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-60 aa of BC062620

  Sequence: MDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADWC

• Full Name: protein kinase N2
• Calculated Molecular Weight: 112 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC062620
• Gene Symbol: PKN2
• Gene ID (NCBI): 5586
• RRID: AB_10638487
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16513
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-PKN2 antibody (Cat# 14608-1-AP) has 5 total citations published in Advanced Science, Molecular Medicine, Cancer Cell International, and Reproduction in Domestic Animals. Research fields span cardiac hypertrophy and heart failure, collective cell migration, immunosuppression in esophageal carcinoma, colorectal cancer prognosis, and porcine Sertoli cell proliferation and apoptosis. Applications include WB, IP, IF, ChIP, and IHC across human, mouse, and pig species.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IP	Adv Sci (Weinh); TRIM40 Drives Pathological Cardiac Hypertrophy and Heart Failure via Ubiquitination of PKN2.; Authors - Risheng Zhao
human	WB,IF	Adv Sci (Weinh); Identification of PKN2 and MOB4 as Coordinators of Collective Cell Migration.; Authors - Artem I Fokin ; KO Validated
human	ChIP	Mol Med; PKN2 enhances the immunosuppressive activity of polymorphonuclear myeloid-derived suppressor cells in esophageal carcinoma by mediating fatty acid oxidation; Authors - Xiao Fu
human	WB	Cancer Cell Int; Upregulation of SNTB1 correlates with poor prognosis and promotes cell growth by negative regulating PKN2 in colorectal cancer; Authors - Liya Liu
pig	WB,IHC	Reprod Domest Anim; miR-26a inhibits proliferation and promotes apoptosis in porcine immature Sertoli cells by targeting the PAK2 gene.; Authors - Maoliang Ran