PLAGL1 Recombinant monoclonal antibody

• 

  WB analysis using 87281-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87281-1-RR (PLAGL1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87281-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87281-1-RR against Human PLAGL1 were performed. The affinity constant is 0.291 nM.

PLAGL1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87281-1-RR

Clone No.252553G12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Lost on transformation 1, LOT 1, LOT1, LOT-1, Pleiomorphic adenoma-like protein 1

---

Tested Applications

• Positive WB detected in: HepG2 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87281-1-RR targets PLAGL1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag23073

  Product name: Recombinant human PLAGL1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 201-463 aa of BC074814

  Sequence: RHTKKTHSQELMKESLQTGDLLSTFHTISPSFQLKAAALPPFPLGASAQNGLASSLPAEVHSLTLSPPEQAAQPMQPLPESLASLHPSVSPGSPPPPLPNHKYNTTSTSYSPLASLPLKADTKGFCNISLFEDLPLQEPQSPQKLNPGFDLAKGNAGKVNLPKELPADAVNLTIPASLDLSPLLGFWQLPPPATQNTFGNSTLALGPGESLPHRLSCLGQQQQEPPLAMGTVSLGQLPLPPIPHVFSAGTGSAILPHFHHAFR

• Full Name: pleiomorphic adenoma gene-like 1
• Calculated Molecular Weight: 463 aa, 51 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC074814
• Gene Symbol: PLAGL1
• Gene ID (NCBI): 5325
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UM63
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAGL1 (Pleomorphic adenoma gene-like 1) is a crucial zinc-finger transcription factor acting as a tumor suppressor, regulating cell cycle, growth (apoptosis), and embryonic development, particularly involved in pancreatic function and imprinted expression (paternal allele). While its family member PLAG1 is an oncogene in salivary tumors, PLAGL1 often suppresses tumors, though its dysregulation is linked to transient neonatal diabetes mellitus (TNDM) and certain cancers, highlighting its complex role in growth control and metabolic homeostasis.