PLEK2 Polyclonal antibody

• 

  WB analysis using 11685-1-AP

  U2OS (positive), Jurkat, Ramos, and U-937 (negative) cells were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 11685-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Caco-2 using 11685-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HT-29 using 11685-1-AP

  IP result of anti-PLEK2 (IP:11685-1-AP, 4ug; Detection:11685-1-AP 1:1000) with HT-29 cells lysate 1760 ug.

• 

  IHC staining of human pancreas cancer using 11685-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11685-1-AP (PLEK2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of mouse spleen using 11685-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11685-1-AP (PLEK2 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of mouse spleen using 11685-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11685-1-AP (PLEK2 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IF Staining of HT-29 using 11685-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using PLEK2 antibody (11685-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HT-29 using 11685-1-AP

  1X10^6 HT-29 cells were intracellularly stained with 0.4 ug Anti-Human PLEK2 (11685-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

PLEK2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11685-1-AP

Publications(20)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

Pleckstrin 2, Pleckstrin-2

---

Tested Applications

• Positive WB detected in: HT-29 cells, U2OS cells, Caco-2 cells, PC-3 cells
• Positive IP detected in: HT-29 cells
• Positive IHC detected in: human pancreas cancer tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HT-29 cells
• Positive FC (Intra) detected in: HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 11 publications below
• WB: See 17 publications below
• IHC: See 9 publications below
• IF: See 3 publications below
• IP: See 1 publications below
• CoIP: See 2 publications below

Product Information

11685-1-AP targets PLEK2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2297

  Product name: Recombinant human PLEK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-353 aa of BC001226

  Sequence: EERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT

• Full Name: pleckstrin 2
• Calculated Molecular Weight: 353 aa, 40 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC001226
• Gene Symbol: PLEK2
• Gene ID (NCBI): 26499
• RRID: AB_2252364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYT0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLEK2 belongs to the Pleckstrin homology domain family and is a 40-kDa protein containing the prototypic PH domains at its amino and carboxyl termini(PMID: 10419454). PLEK2 associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. PLEK2 interacts with the actin cytoskeleton to induce cell spreading.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	J Clin Invest; Loss of pleckstrin-2 reverts lethality and vascular occlusions in JAK2V617F-positive myeloproliferative neoplasms.; Authors - Baobing Zhao ; KO Validated
human	WB,IHC	Cancer Lett; Pleckstrin-2 promotes tumour immune escape from NK cells by activating the MT1-MMP-MICA signalling axis in gastric cancer; Authors - Deli Mao ; KD Validated
human	WB	Am J Pathol; Pleckstrin-2 Mediates the Activation of AKT in Prostate Cancer and Is Repressed by Androgen Receptor; Authors - Xu Han
mouse	WB,IF	Haematologica; Targeted shRNA screening identified critical roles of pleckstrin-2 in erythropoiesis.; Authors - Baobing Zhao ; KD Validated
		Int J Cancer; PLEK2 mediates metastasis and vascular invasion via the ubiquitin-dependent degradation of SHIP2 in non-small cell lung cancer.; Authors - Dong-Ming Wu
human	WB,IHC,IF	Mol Carcinog; PLEK2 mediates metastasis and invasion via α5-nAChR activation in nicotine-induced lung adenocarcinoma; Authors - Qiang Li ; KD Validated