PLEK2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PLEK2 Polyclonal antibody (11685-1-AP)

• Featured Product
• KD/KO Validated

PLEK2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11685-1-AP Copied!

Publications (22)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

Pleckstrin 2, Pleckstrin-2

• 

  WB analysis using 11685-1-AP

  U2OS (positive), Jurkat, Ramos, and U-937 (negative) cells were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11685-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Caco-2 using 11685-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 11685-1-AP (PLEK2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HT-29 using 11685-1-AP

  IP result of anti-PLEK2 (IP:11685-1-AP, 4ug; Detection:11685-1-AP 1:1000) with HT-29 cells lysate 1760 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 11685-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11685-1-AP (PLEK2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 11685-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11685-1-AP (PLEK2 Antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse spleen using 11685-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 11685-1-AP (PLEK2 Antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HT-29 using 11685-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HT-29 cells using PLEK2 antibody (11685-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HT-29 using 11685-1-AP

  1X10^6 HT-29 cells were intracellularly stained with 0.4 ug Anti-Human PLEK2 (11685-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PLEK2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-29 cells, U2OS cells, Caco-2 cells, PC-3 cells
• Positive IP detected in: HT-29 cells
• Positive IHC detected in: human pancreas cancer tissue, mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HT-29 cells
• Positive FC (Intra) detected in: HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11685-1-AP targets PLEK2 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2297

  Product name: Recombinant human PLEK2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 90-353 aa of BC001226

  Sequence: EERDAWAFEITGAIHAGQPGKVQQLHSLRNSFKLPPHISLHRIVDKMHDSNTGIRSSPNMEQGSTYKKTFLGSSLVDWLISNSFTASRLEAVTLASMLMEENFLRPVGVRSMGAIRSGDLAEQFLDDSTALYTFAESYKKKISPKEEISLSTVELSGTVVKQGYLAKQGHKRKNWKVRRFVLRKDPAFLHYYDPSKEENRPVGGFSLRGSLVSALEDNGVPTGVKGNVQGNLFKVITKDDTHYYIQASSKAERAEWIEAIKKLT

• Full Name: pleckstrin 2
• Calculated Molecular Weight: 353 aa, 40 kDa
• Observed Molecular Weight: 38-40 kDa
• GenBank Accession Number: BC001226
• Gene Symbol: PLEK2
• Gene ID (NCBI): 26499
• RRID: AB_2252364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NYT0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLEK2 belongs to the Pleckstrin homology domain family and is a 40-kDa protein containing the prototypic PH domains at its amino and carboxyl termini(PMID: 10419454). PLEK2 associates with membrane-bound phosphatidylinositols generated by phosphatidylinositol 3-kinase. PLEK2 interacts with the actin cytoskeleton to induce cell spreading.

Publications

What published studies show

PLEK2 (Pleckstrin-2) antibody (Cat# 11685-1-AP) has 22 citations across journals including Journal of Clinical Investigation, Journal of Experimental & Clinical Cancer Research, Cancer Letters, Cell Death & Disease, Haematologica, Communications Biology, International Journal of Cancer, American Journal of Pathology, Cell Signaling, Molecular Carcinogenesis, and others. Research fields span oncology (lung, gastric, pancreatic, breast, esophageal, and head and neck cancers), myeloproliferative neoplasms, erythropoiesis, and placental biology.

Automatically generated from the 22 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cancer Commun (Lond); PLEK2 promotes cancer stemness and tumorigenesis of head and neck squamous cell carcinoma via the c-Myc-mediated positive feedback loop; Authors - Xinyuan Zhao ; KD Validated
mouse	WB,IHC	J Clin Invest; Loss of pleckstrin-2 reverts lethality and vascular occlusions in JAK2V617F-positive myeloproliferative neoplasms.; Authors - Baobing Zhao ; KO Validated
human	IHC,CoIP	J Exp Clin Cancer Res; PLEK2 promotes gallbladder cancer invasion and metastasis through EGFR/CCL2 pathway.; Authors - Hui Shen
mouse	WB,IP	J Clin Invest; Targeting pleckstrin-2-Akt signaling reduces proliferation in myeloproliferative neoplasm models; Authors - Xu Han
human	WB	Mol Biomed; Unveiling the role of Pleckstrin-2 in tumor progression and immune modulation: insights from a comprehensive pan-cancer analysis with focus on lung cancer; Authors - Enzhi Yin ; KD Validated
human	WB,IHC	Cell Death Dis; TGF-β-induced PLEK2 promotes metastasis and chemoresistance in oesophageal squamous cell carcinoma by regulating LCN2.; Authors - Feng Wang ; KD Validated