PLK2 Recombinant monoclonal antibody, PBS Only

• 

  IF Staining of hTERT-RPE1 using 83431-1-RR (same clone as 83431-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed hTERT-RPE1 cells using PLK2 antibody (83431-1-RR, Clone: 230520B2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Acetyl-Tubulin (Lys40) antibody (66200-1-Ig, Clone: 7E5H8, red). This data was developed using the same antibody clone with 83431-1-PBS in a different storage buffer formulation.

• 

  FC experiment of A549 using 83431-1-RR (same clone as 83431-1-PBS)

  1x10^6 A549 cells were intracellularly stained with 0.25 ug Plk2 Recombinant Antibody (83431-1-RR, Clone:230520B2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C). This data was developed using the same antibody clone with 83431-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83431-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83431-1-RR against Human PLK2 were performed. The affinity constant is 1.53 nM.

PLK2 Uni-rAb^® Recombinant Antibody for IF/ICC, FC (Intra), ELISA

Cat No. 83431-1-PBS

Clone No.230520B2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra), ELISA

Synonyms

PLK-2, PLK 2, hSNK, hPlk2, EC:2.7.11.21

---

Product Information

83431-1-PBS targets PLK2 in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29837

  Product name: Recombinant human PLK2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 357-497 aa of BC013879

  Sequence: SSPAKNFFKKAAAALFGGKKDKARYIDTHNRVSKEDEDIYKLRHDLKKTSITQQPSKHRTDEELQPPTTTVARSGTPAVENKQQIGDAIRMIVRGTLGSCSSSSECLEDSTMGSVADTVARVLRGCLENMPEADCIPKEQL

• Full Name: polo-like kinase 2 (Drosophila)
• Calculated Molecular Weight: 685 aa, 78 kDa
• GenBank Accession Number: BC013879
• Gene Symbol: PLK2
• Gene ID (NCBI): 10769
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NYY3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.