Home
Products
Primary Antibodies
PLP1 Polyclonal antibody, PBS Only (33901-1-PBS)

Filter: AllIHCIF-P

IHC staining of mouse brain using 33901-1-AP (same clone as 33901-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.
IHC staining of human brain using 33901-1-AP (same clone as 33901-1-PBS)
Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 33901-1-AP (same clone as 33901-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.
IHC staining of rat brain using 33901-1-AP (same clone as 33901-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 33901-1-AP (PLP1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 33901-1-AP (same clone as 33901-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using PLP1 antibody (33901-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 33901-1-AP (same clone as 33901-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using PLP1 antibody (33901-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CoraLite® Plus 488 MBP antibody (CL488-10458, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.
×
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse brain tissue using PLP1 antibody (33901-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4), CoraLite® Plus 488 MBP antibody (CL488-10458, green). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 33901-1-PBS in a different storage buffer formulation.

PLP1 Polyclonal antibody, PBS Only

Name: PLP1 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 33901-1-PBS

PLP1 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 33901-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, IF-P, Indirect ELISA

Synonyms

Lipophilin, Myelin proteolipid protein, PLP

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

33901-1-PBS targets PLP1 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag38738 Product name: Recombinant human PLP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 89-151 aa of NM_000533.4 Sequence: EGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDK Predict reactive species
Full Name	proteolipid protein 1
Calculated Molecular Weight	30kDa，277aa
GenBank Accession Number	NM_000533.4
Gene Symbol	PLP1
Gene ID (NCBI)	5354
RRID	AB_3743106
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity Purification
UNIPROT ID	P60201
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Myelin proteolipid protein is also named PLP1 and Lipophilin. Plp1 is abundantly expressed by oligodendrocytes of the central nervous system (CNS), where it encodes the most abundant protein in CNS myelin (PMID: 19452287). Plp1 expression preferentially occurs during early postnatal development, primarily as the DM20 isoform (PMID: 37293625).