PLUNC Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PLUNC Polyclonal antibody, PBS Only (10413-1-PBS)

• 

  WB analysis of mouse lung using 10413-1-AP (same clone as 10413-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10413-1-AP (PLUNC antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10413-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse lung using 10413-1-AP (same clone as 10413-1-PBS)

  IP result of anti-PLUNC (IP:10413-1-AP, 4ug; Detection:10413-1-AP 1:300) with mouse lung tissue lysate 3600ug. This data was developed using the same antibody clone with 10413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 10413-1-AP (same clone as 10413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10413-1-AP (PLUNC antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse lung using 10413-1-AP (same clone as 10413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10413-1-AP (PLUNC antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10413-1-AP (same clone as 10413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10413-1-AP (PLUNC Antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 10413-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10413-1-AP (same clone as 10413-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10413-1-AP (PLUNC Antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 10413-1-PBS in a different storage buffer formulation.

PLUNC Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10413-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

BPI fold-containing family A member 1, BPIFA1, Lung-specific protein X, LUNX, NASG

---

Product Information

10413-1-PBS targets PLUNC in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0629

  Product name: Recombinant human PLUNC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-256 aa of BC012549

  Sequence: MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV

• Full Name: palate, lung and nasal epithelium associated
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012549
• Gene Symbol: PLUNC
• Gene ID (NCBI): 51297
• RRID: AB_2166093
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP55
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLUNC, also named as LUNX, NASG and SPURT, belongs to the BPI/LBP/Plunc superfamily and Plunc family. PLUNC may be involved in the airway inflammatory response after exposure to irritants. It is associated with tumor progression. PLUNC plays a role in innate immune responses of the upper airways.