PLZF Monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of Ramos using 66672-1-Ig (same clone as 66672-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human testis using 66672-1-Ig (same clone as 66672-1-PBS)

  human testis tissue were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Ramos using 66672-1-Ig (same clone as 66672-1-PBS)

  Ramos cells were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:7500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 66672-1-Ig (same clone as 66672-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:7500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 66672-1-Ig (same clone as 66672-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:7500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 66672-1-Ig (same clone as 66672-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 66672-1-Ig (same clone as 66672-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 66672-1-Ig (PLZF antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66672-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP50366-1

  Cytometric bead array standard curve of MP50366-1, PLZF Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66672-2-PBS. Detection antibody: 66672-1-PBS. Standard:Ag25180. Range: 0.781-100 ng/mL.

• 

  Cytometric bead array standard curve of MP50366-2

  Cytometric bead array standard curve of MP50366-2, PLZF Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 66672-3-PBS. Detection antibody: 66672-1-PBS. Standard:Ag25180. Range: 0.781-100 ng/mL.

PLZF Monoclonal Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 66672-1-PBS

Clone No.2E6F12

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

ZBTB16, 2E6F12, Zinc finger and BTB domain-containing protein 16, Zinc finger protein 145, Zinc finger protein PLZF

---

Product Information

66672-1-PBS targets PLZF as part of a matched antibody pair:

MP50366-1: 66672-2-PBS capture and 66672-1-PBS detection (validated in Cytometric bead array)

MP50366-2: 66672-3-PBS capture and 66672-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25180

  Product name: Recombinant human PLZF protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 101-400 aa of BC026902

  Sequence: DLLYAAEILEIEYLEEQCLKMLETIQASDDNDTEATMADGGAEEEEDRKARYLKNIFISKHSSEESGYASVAGQSLPGPMVDQSPSVSTSFGLSAMSPTKAAVDSLMTIGQSLLQGTLQPPAGPEEPTLAGGGRHPGVAEVKTEMMQVDEVPSQDSPGAAESSISGGMGDKVEERGKEGPGTPTRSSVITSARELHYGREESAEQVPPPAEAGQAPTGRPEHPAPPPEKHLGIYSVLPNHKADAVLSMPSSVTSGLHVQPALAVSMDFSTYGGLLPQGFIQRELFSKLGELAVGMKSESR

• Full Name: zinc finger and BTB domain containing 16
• Calculated Molecular Weight: 673 aa, 74 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC026902
• Gene Symbol: PLZF
• Gene ID (NCBI): 7704
• RRID: AB_2882026
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q05516
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PLZF, also named as Zinc finger protein 145, is a 673 amino acid protein, which belongs to the krueppel C2H2-type zinc-finger protein family. PLZF is expressed in bone marrow, early myeloid cell lines and peripheral blood mononuclear cells. PLZF may play a role in myeloid maturation and in the development and/or maintenance of other differentiated tissues.