PMM2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PMM2 Polyclonal antibody, PBS Only (10666-1-PBS)

• 

  WB analysis of multi-tissue using 10666-1-AP (same clone as 10666-1-PBS)

  WB results of 10666-1-AP (PMM2 antibody) on several lysates. This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 10666-1-AP (same clone as 10666-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10666-1-AP (PMM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 10666-1-AP (same clone as 10666-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 10666-1-AP (PMM2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse lung using 10666-1-AP (same clone as 10666-1-PBS)

  IP result of anti-PMM2 (IP:10666-1-AP, 4ug; Detection:10666-1-AP 1:1000) with mouse lung tissue lysate 3600ug. This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10666-1-AP (same clone as 10666-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10666-1-AP (PMM2 Antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10666-1-AP (same clone as 10666-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10666-1-AP (PMM2 Antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 10666-1-AP (same clone as 10666-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10666-1-AP (PMM2 antibody) at dilution of 1:100 (under 25x lens). This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10666-1-AP (same clone as 10666-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PMM2 antibody (10666-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10666-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PMM2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10666-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

phosphomannomutase 2, EC:5.4.2.8

---

Product Information

10666-1-PBS targets PMM2 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1031

  Product name: Recombinant human PMM2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-246 aa of BC008310

  Sequence: MAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS

• Full Name: phosphomannomutase 2
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28-30 kDa
• GenBank Accession Number: BC008310
• Gene Symbol: PMM2
• Gene ID (NCBI): 5373
• RRID: AB_2166973
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15305
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PMM2(Phosphomannomutase 2) belongs to the eukaryotic PMM family. It is involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. PMM2 catalyzes the second step in the conversion of fructose-6P to GDP-mannose.