PNPLA7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PNPLA7 Polyclonal antibody, PBS Only (27787-1-PBS)

• 

  IHC staining of mouse cerebellum using 27787-1-AP (same clone as 27787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27787-1-AP (PNPLA7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27787-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 27787-1-AP (same clone as 27787-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 27787-1-AP (PNPLA7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27787-1-PBS in a different storage buffer formulation.

PNPLA7 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 27787-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

C9orf111, NTE R1, NTEL1, RP11 48C7.2

---

Product Information

27787-1-PBS targets PNPLA7 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27184

  Product name: Recombinant human PNPLA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 302-468 aa of NM_001098537

  Sequence: MVSVASVAAGKAKKQVFYGEEERLKKPPRLQESCDSDHGGGRPAAAGPLLKRSHSVPAPSIRKQILEELEKPGAGDPDPSAPQGGPGSATSDLGMACDRARVFLHSDEHPGSSVASKSRKSVMVAEIPSTVSQHSESHTDETLASRKSDAIFRAAKKDLLTLMKLEDS

• Full Name: patatin-like phospholipase domain containing 7
• Calculated Molecular Weight: 146 kDa
• GenBank Accession Number: NM_001098537
• Gene Symbol: PNPLA7
• Gene ID (NCBI): 375775
• RRID: AB_3669623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZV29
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PNPLA7 (Patatin-like phospholipase domain-containing protein 7), also termed NTE-related 1 (NTE-R1) or NRE, is a member of the PNPLAs family, which is conserved protein in mice, rats and humans. It serves key roles in triglyceride hydrolysis, energy metabolism, lipid droplet (LD), and in regulation of adipocyte differentiation. It is reported that PNPLA7 was down-regulated in HCC through hypermethylation of its promoter, which indicates that PNPLA7 may be a potential biomarker for HCC diagnosis (PMID: 16799181, 27347198).