POLG Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POLG Polyclonal antibody, PBS Only (14110-1-PBS)

• 

  WB analysis using 14110-1-AP (same clone as 14110-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14110-1-AP (POLG antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14110-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293T using 14110-1-AP (same clone as 14110-1-PBS)

  WB result of POLG antibody (14110-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-POLG transfected HEK-293T cells. This data was developed using the same antibody clone with 14110-1-PBS in a different storage buffer formulation.

POLG Polyclonal Antibody for WB, Indirect ELISA

Cat No. 14110-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

3'-5' exodeoxyribonuclease, 5'-deoxyribose-phosphate lyase, DNA polymerase subunit gamma-1, EC:2.7.7.7, EC:3.1.11.-

---

Product Information

14110-1-PBS targets POLG in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5256

  Product name: Recombinant human POLG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 888-1239 aa of BC042571

  Sequence: GADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP

• Full Name: polymerase (DNA directed), gamma
• Calculated Molecular Weight: 140 kDa
• Observed Molecular Weight: 130-150 kDa
• GenBank Accession Number: BC042571
• Gene Symbol: POLG
• Gene ID (NCBI): 5428
• RRID: AB_3669178
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54098
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

POLG is the catalytic subunit of DNA polymerase gamma solely responsible for the replication of mitochondrial DNA (mtDNA). POLG replicates both heavy and light strands of the circular mtDNA genome using a single-stranded DNA template, RNA primers, and the four deoxyribonucleoside triphosphates as substrates (PMID:11477093; 11897778; 15917273; 19837034; 9558343).