POM121 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• POM121 Polyclonal antibody, PBS Only (15645-1-PBS)

• 

  WB analysis using 15645-1-AP (same clone as 15645-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15645-1-AP (POM121 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15645-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 15645-1-AP (same clone as 15645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 15645-1-AP (POM121 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15645-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 15645-1-AP (same clone as 15645-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 15645-1-AP (POM121 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15645-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 15645-1-AP (same clone as 15645-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 15645-1-AP (POM121 antibody) at dilution of 1:200 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15645-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HCT 116 using 15645-1-AP (same clone as 15645-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HCT 116 cells using POM121 antibody (15645-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 15645-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

POM121 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 15645-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

POM121A, NUP121, Nucleoporin Nup121, Nuclear envelope pore membrane protein POM 121A, Nuclear envelope pore membrane protein POM 121

---

Product Information

15645-1-PBS targets POM121 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8177

  Product name: Recombinant human POM121 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 635-984 aa of BC008794

  Sequence: SQSLHTAVPTATSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAEGQPPGAAKPALAPSFGSSFTFGNSAAPAAAPTPAPPSMIKVVPAYVPTPIHPIFGGATHSAFGLKATASAFGAPASSQPAFGGSTAVFFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINVATPGSSTTTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNVSSTTESKPVFGGTATPTFGLNTPAPGVGTSGSSLSFGASSAPAQGFVGVAPFGSAALSFSIGAGSKTPGARQRLQARRQHTRKK

• Full Name: POM121 membrane glycoprotein (rat)
• Calculated Molecular Weight: 984 aa, 99 kDa
• Observed Molecular Weight: 140-150 kDa
• GenBank Accession Number: BC008794
• Gene Symbol: POM121
• Gene ID (NCBI): 9883
• RRID: AB_2878160
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96HA1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

POM121 is an integral membrane protein that localizes to the central spoke ring complex and participates in anchoring the nuclear pore complex to the nuclear envelope. Catalog#15645-1-AP do well in identifying the nuclear envelope in immunofluorescence experiments.