Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PPFIA3 Recombinant monoclonal antibody

PPFIA3 Uni-rAb® Recombinant Antibody for FC (Intra)

Cat No. CL488-83142-4
Clone No.230459F6

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

FC (Intra)

230459F6, KIAA0654, Liprin-alpha-3, Protein tyrosine phosphatase receptor type f polypeptide-interacting protein alpha-3, PTPRF-interacting protein alpha-3

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83142-4 targets PPFIA3 in FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1971

Product name: Recombinant human PPFIA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-277 aa of BC021255

Sequence: APASSRTSTGNVWMTHEEMESLTATTKPILAYGDMNHEWVGNDWLPSLGLPQYRSYFMESLVDARMLDHLNKKELRGQLKMVDSFHRVSLHYGIMCLKRLNYDRKDLERRREESQTQIRDVMVWSNERVMGWVSGLGLKEFATNLTESGVHGALLALDETFDYSDLALLLQIPTQNAQARQLLEKEFSNLISLGTDRRLDEDSAKSFSRSPSWRKMFREKDLRGVTPDSAEMLPPNFRSAAAGALGSPGLPLRKLQPEGQTSGSSRADGVSVRTYSC

Predict reactive species
Full Name protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 3
Calculated Molecular Weight 1194 aa, 133 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC021255
Gene Symbol PPFIA3
Gene ID (NCBI) 8541
RRIDAB_3747360
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75145
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PPFIA3, also named as KIAA0654, belongs to the liprin family and Liprin-alpha subfamily. PPFIA3 may regulate the disassembly of focal adhesions. It may localize receptor-like tyrosine phosphatases type 2A at specific sites on the plasma membrane, possibly regulating their interaction with the extracellular environment and their association with substrates. PPFIA3 exhibites more than 5 fold accumulations in the monoribosome fraction. PPFIA3 is decreased at the protein level by the miR-99 family but not in the luciferase reporter with the 3'UTR of PPFIA3. (PMID:21212412)

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PPFIA3 antibody CL488-83142-4Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...