Cyclophilin A Polyclonal antibody

• 

  WB analysis of Jurkat using 51040-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 51040-1-AP (Cyclophilin A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

Cyclophilin A Polyclonal Antibody for WB, ELISA

Cat No. 51040-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Cyclophilin A, Cyclosporin A binding protein, CYPA, CYPH, PPIA, PPIase A, Rotamase A

---

Tested Applications

• Positive WB detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

51040-1-AP targets Cyclophilin A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0480

  Product name: Recombinant human PPIA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC000689

  Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

• Full Name: peptidylprolyl isomerase A (cyclophilin A)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC000689
• Gene Symbol: PPIA
• Gene ID (NCBI): 5478
• RRID: AB_2237515
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62937
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPIA, also named as CYPA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Int J Oncol; Proteomics-based identification of a group of apoptosis-related proteins and biomarkers in gastric cancer.; Authors - Zhigang Bai