Cyclophilin A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cyclophilin A Polyclonal antibody (10720-1-AP)

• Featured Product
• KD/KO Validated

Cyclophilin A Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), ELISA

Cat No. 10720-1-AP Copied!

Publications (50)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

PPIA, Cyclosporin A binding protein, Cyclosporin A-binding protein, CYPA, CYPH

• 

  WB analysis using 10720-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10720-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Raji using 10720-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 10720-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 10720-1-AP (Cyclophilin A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 10720-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis using 10720-1-AP (Cyclophilin A antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 10720-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HepG2 cells using Cyclophilin A antibody (10720-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 10720-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug Cyclophilin A Polyclonal antibody (10720-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cyclophilin A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, C6 cells, Raji cells, HepG2 cells, K-562 cells, NIH/3T3 cells
• Positive IHC detected in: human colon cancer tissue, human placenta tissue, human tonsillitis tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10720-1-AP targets Cyclophilin A in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1120

  Product name: Recombinant human CYPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC005320

  Sequence: MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQLE

• Full Name: peptidylprolyl isomerase A (cyclophilin A)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC005320
• Gene Symbol: PPIA
• Gene ID (NCBI): 5478
• RRID: AB_2237516
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P62937
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclophilin A, also named as PPIA and Rotamase A, belongs to the cyclophilin-type PPIase family and PPIase A subfamily. PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. PPIA forms a trimolecular complex with cyclophilin and calcineurins to inhibit calcineurin phosphatase activity. PPIA is incorporated into the virion of the type 1 human immunodeficiency virus (HIV-1) via a direct interaction with the capsid domain of the viral Gag polyprotein and is crucial for efficient viral replication.

Publications

What published studies show

The Rabbit Monoclonal Antibody to Cyclophilin A (PPIA), catalog number 10720-1-AP, has 50 citations. Publications appear in high-impact journals including Nature Communications, Cell Research, Cancer Research, Molecular Cell, Science Advances, Brain, and PLoS Pathogens. Research fields span virology (SARS-CoV-2, EBV, HBV), neurodegeneration (ALS, FTD), oncology (lung, gastric, colorectal, nasopharyngeal cancers), immunology/inflammation, metabolism, proteomics, and drug discovery, with applications primarily in Western blot, IHC, and IF.

Automatically generated from the 50 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Res; Comparison of viral RNA-host protein interactomes across pathogenic RNA viruses informs rapid antiviral drug discovery for SARS-CoV-2.; Authors - Shaojun Zhang
		Cancer Res; Genetic Drivers of Sensitivity or Resistance to RAS(ON) Multi-Selective Inhibitors in NRAS-Mutated Melanoma.; Authors - Mona Foth
human	WB	Mol Neurodegener; Decoding distinctive features of plasma extracellular vesicles in amyotrophic lateral sclerosis.; Authors - Laura Pasetto
pig	WB	Nat Commun; Cyclophilin A stabilizes the capsid protein p72 to facilitate African swine fever virus replication.; Authors - Hui Kong ; KO Validated
human	WB,IHC	Nat Commun; PPIA dictates NRF2 stability to promote lung cancer progression; Authors - Weiqiang Lu
		Nat Commun; A dual-pronged host-directed therapeutic targeting cyclophilin A and pathogenic interferon response abrogates virus-triggered pregnancy pathologies.; Authors - Wenzhe Yu