PPM1B Monoclonal antibody

• 

  WB analysis using 67647-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67647-1-Ig (PPM1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  WB analysis using 67647-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67647-1-Ig (PPM1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human breast cancer using 67647-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 67647-1-Ig

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 67647-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse skeletal muscle using 67647-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 67647-1-Ig

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PPM1B antibody (67647-1-Ig, Clone: 2C7H2 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1).

• 

  Affinity and Kinetic Characterization of 67647-1-Ig

  Biolayer interferometry (BLl) kinetic assay of 67647-1-Ig against Human PPM1B was performed. The affinity constant is below 1 pM.

PPM1B Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67647-1-Ig

Clone No.2C7H2

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

2C7H2, EC:3.1.3.16, PP2C beta, PP2CB, PP2C-beta

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells
• Positive IHC detected in: human breast cancer tissue, mouse skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 1 publications below

Product Information

67647-1-Ig targets PPM1B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: monkey
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3871

  Product name: Recombinant human PPM1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-192 aa of BC012002

  Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

• Full Name: protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
• Calculated Molecular Weight: 479 aa, 53 kDa
• Observed Molecular Weight: 36, 53 kDa
• GenBank Accession Number: BC012002
• Gene Symbol: PPM1B
• Gene ID (NCBI): 5495
• RRID: AB_2882847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O75688
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPM1B can identify 4 isoforms with the WM of 36-55 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		bioRxiv; Epigenetic modulation of NLRP6 inflammasome sensor as a therapeutic modality to reduce necroptosis-driven gastrointestinal mucosal dysfunction in HIV/SIV infection; Authors - Lakmini S Premadasa
monkey	IF	Cell Commun Signal; Epigenetic modulation of the NLRP6 inflammasome sensor as a therapeutic modality to reduce necroptosis-driven gastrointestinal mucosal dysfunction in HIV/SIV infection; Authors - Lakmini S Premadasa