Filter: AllWBSample testIHCIF/ICCCytometric bead arrayAffinity

WB analysis using 67647-1-Ig (same clone as 67647-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67647-1-Ig (PPM1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67647-1-Ig (PPM1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
WB analysis using 67647-1-Ig (same clone as 67647-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67647-1-Ig (PPM1B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
Sample test of MP51322-1
Sample test of MP51322-1, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-2-PBS.
Sample test of MP51322-2
Sample test of MP51322-2, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-3-PBS.
Sample test of MP51322-3
Sample test of MP51322-3, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-4-PBS.
Sample test of MP51322-4
Sample test of MP51322-4, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-5-PBS.
IHC staining of human breast cancer using 67647-1-Ig (same clone as 67647-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
IHC staining of human breast cancer using 67647-1-Ig (same clone as 67647-1-PBS)
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 67647-1-Ig (same clone as 67647-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
IHC staining of mouse skeletal muscle using 67647-1-Ig (same clone as 67647-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse skeletal muscle tissue slide using 67647-1-Ig (PPM1B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
IF Staining of A431 using 67647-1-Ig (same clone as 67647-1-PBS)
Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PPM1B antibody (67647-1-Ig, Clone: 2C7H2 ) at dilution of 1:1000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 67647-1-PBS in a different storage buffer formulation.
Cytometric bead array standard curve of MP51322-1
Cytometric bead array standard curve of MP51322-1, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-2-PBS. Standard:Ag3871. Range: 0.195-200 ng/mL.
Cytometric bead array standard curve of MP51322-2
Cytometric bead array standard curve of MP51322-2, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-3-PBS. Standard:Ag3871. Range: 0.195-200 ng/mL.
Cytometric bead array standard curve of MP51322-3
Cytometric bead array standard curve of MP51322-3, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-4-PBS. Standard:Ag3871. Range: 0.195-200 ng/mL.
Cytometric bead array standard curve of MP51322-4
Cytometric bead array standard curve of MP51322-4, PPM1B Monoclonal Matched Antibody Pair, PBS Only. Capture antibody: 67647-1-PBS. Detection antibody: 67647-5-PBS. Standard:Ag3871. Range: 0.195-200 ng/mL.
Affinity and Kinetic Characterization of 67647-1-Ig
Biolayer interferometry (BLl) kinetic assay of 67647-1-Ig against Human PPM1B was performed. The affinity constant is below 1 pM.

PPM1B Monoclonal antibody, PBS Only (Capture)

PPM1B Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test

Cat No. 67647-1-PBS

Clone No.2C7H2

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test

Synonyms

2C7H2, EC:3.1.3.16, PP2C beta, PP2CB, PP2C-beta

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67647-1-PBS targets PPM1B as part of a matched antibody pair:

MP51322-1: 67647-1-PBS capture and 67647-2-PBS detection (validated in Cytometric bead array)

MP51322-2: 67647-1-PBS capture and 67647-3-PBS detection (validated in Cytometric bead array)

MP51322-3: 67647-1-PBS capture and 67647-4-PBS detection (validated in Cytometric bead array)

MP51322-4: 67647-1-PBS capture and 67647-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity	human, mouse, rat
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag3871 Product name: Recombinant human PPM1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-192 aa of BC012002 Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI Predict reactive species
Full Name	protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Calculated Molecular Weight	479 aa, 53 kDa
Observed Molecular Weight	36, 53 kDa
GenBank Accession Number	BC012002
Gene Symbol	PPM1B
Gene ID (NCBI)	5495
RRID	AB_2882847
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	O75688
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.