PPM1B Monoclonal antibody, PBS Only (Capture)

PPM1B Monoclonal Antibody for WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 67647-1-PBS
Clone No.2C7H2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Indirect ELISA, Sample test

2C7H2, EC:3.1.3.16, PP2C beta, PP2CB, PP2C-beta

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67647-1-PBS targets PPM1B as part of a matched antibody pair:

MP51322-1: 67647-1-PBS capture and 67647-2-PBS detection (validated in Cytometric bead array)

MP51322-2: 67647-1-PBS capture and 67647-3-PBS detection (validated in Cytometric bead array)

MP51322-3: 67647-1-PBS capture and 67647-4-PBS detection (validated in Cytometric bead array)

MP51322-4: 67647-1-PBS capture and 67647-5-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3871

Product name: Recombinant human PPM1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-192 aa of BC012002

Sequence: MSIVLVCFSNAPKVSDEAVKKDSELDKHLESRVEEIMEKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKRNVIEAVYSRLNPHRESDGASDEAEESGSQGKLVEALRQMRINHRGNYRQLLEEMLTSYRLAKVEGEESPAEPAATATSSNSDAGNPVTMQESHTESESGLAELDSSNEDAGTKMSGEKI

Predict reactive species
Full Name protein phosphatase 1B (formerly 2C), magnesium-dependent, beta isoform
Calculated Molecular Weight 479 aa, 53 kDa
Observed Molecular Weight 36, 53 kDa
GenBank Accession NumberBC012002
Gene Symbol PPM1B
Gene ID (NCBI) 5495
RRIDAB_2882847
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDO75688
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PPM1B can identify 4 isoforms with the WM of 36-55 kDa.

Loading...
||
New chat Able
正在加载,请稍候...