PPM1D Monoclonal antibody

• 

  WB analysis of MCF-7 using 67440-1-Ig

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 67440-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rat brain using 67440-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 67440-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 67440-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U2OS using 67440-1-Ig

  U2OS cells were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 67440-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67440-1-Ig (PPM1D antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 67440-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67440-1-Ig (PPM1D antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 67440-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67440-1-Ig (PPM1D antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

PPM1D Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67440-1-Ig

Clone No.2D6D5

Publications(1)

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

PP2C DELTA, PPM1D, Protein phosphatase 1D, WIP1

---

Tested Applications

• Positive WB detected in: MCF-7 cells, HEK-293 cells, U2OS cells, pig brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

67440-1-Ig targets PPM1D in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Pig
• Cited Reactivity: mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24761

  Product name: Recombinant human PPM1D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 254-423 aa of BC060877

  Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE

• Full Name: protein phosphatase 1D magnesium-dependent, delta isoform
• Observed Molecular Weight: 67 kDa, 47 kDa
• GenBank Accession Number: BC060877
• Gene Symbol: PPM1D
• Gene ID (NCBI): 8493
• RRID: AB_2882676
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15297
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Exp Neurol; PPM1D ameliorates Alzheimer's disease by promoting mitophagy; Authors - Aiming Wang