PPM1D Monoclonal antibody, PBS Only

• 

  WB analysis of MCF-7 using 67440-1-Ig (same clone as 67440-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67440-1-Ig (same clone as 67440-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67440-1-Ig (same clone as 67440-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67440-1-Ig (same clone as 67440-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67440-1-Ig (same clone as 67440-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U2OS using 67440-1-Ig (same clone as 67440-1-PBS)

  U2OS cells were subjected to SDS PAGE followed by western blot with 67440-1-Ig (PPM1D antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67440-1-Ig (same clone as 67440-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67440-1-Ig (PPM1D antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67440-1-Ig (same clone as 67440-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67440-1-Ig (PPM1D antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67440-1-Ig (same clone as 67440-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67440-1-Ig (PPM1D antibody), at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67440-1-PBS in a different storage buffer formulation.

PPM1D Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67440-1-PBS

Clone No.2D6D5

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat, Pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

PP2C DELTA, PPM1D, Protein phosphatase 1D, WIP1

---

Product Information

67440-1-PBS targets PPM1D in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples.

• Tested Reactivity: Human, Mouse, Rat, Pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24761

  Product name: Recombinant human PPM1D protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 254-423 aa of BC060877

  Sequence: NGPVRRSTVIDQIPFLAVARALGDLWSYDFFSGEFVVSPEPDTSVHTLDPQKHKYIILGSDGLWNMIPQQDAISMCQDQEEKKYLMGEHGQSCAKMLVNRALGRWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELYLNLTDSPSYNSQETCVMTPSPCSTPPVKSLE

• Full Name: protein phosphatase 1D magnesium-dependent, delta isoform
• Observed Molecular Weight: 67 kDa, 47 kDa
• GenBank Accession Number: BC060877
• Gene Symbol: PPM1D
• Gene ID (NCBI): 8493
• RRID: AB_2882676
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O15297
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PPM1D (also known as PP2Cd and WIP1) is a member of the PPM family, which is characterized by Mg2+/Mn2+-dependent activity and relative insensitivity to okadaic acid. The PPM1D gene is aberrantly amplified in a range of common cancers and encodes a protein phosphatase that is a potential therapeutic target (PMID: 17700519). This antibody can be detected two bands of 47 and 67 Kda.