PPM1F Monoclonal antibody, PBS Only

• 

  WB analysis using 68626-1-Ig (same clone as 68626-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68626-1-Ig (PPM1F antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68626-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68626-1-Ig (same clone as 68626-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68626-1-Ig (PPM1F antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68626-1-PBS in a different storage buffer formulation.

PPM1F Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68626-1-PBS

Clone No.2A2E8

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

CaM kinase phosphatase, CaMKPase, FEM 2, hFEM 2, KIAA0015, Partner of PIX 2, POPX2, PPM1F, Protein fem 2 homolog, Protein phosphatase 1F

---

Product Information

68626-1-PBS targets PPM1F in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10316

  Product name: Recombinant human PPM1F protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 104-453 aa of BC071989

  Sequence: EEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQKQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAVHVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQQGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGSEDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLEGGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS

• Full Name: protein phosphatase 1F (PP2C domain containing)
• Calculated Molecular Weight: 453 aa, 50 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC071989
• Gene Symbol: PPM1F
• Gene ID (NCBI): 9647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49593
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Mg2+/Mn2+-dependent protein phosphatase 1F (PPM1F) belongs to the PP2C family of Ser/Thr protein phosphatases and is the critical enzyme responsible for dephosphorylating the threonine motif. PPM1F is ubiquitous in various tissues and organs (PMID: 26498692). High expression of PPM1F was positively associated with poor survival and tumor recurrence in patients with cancers and PPM1F might be a potential biomarker in HCC patients (PMID: 30470261).