• Featured Product
  • KD/KO Validated

PDP1 Recombinant monoclonal antibody

PDP1 Uni-rAb® Recombinant Antibody for WB, IHC, ELISA
Cat No. 84612-3-RR
Clone No.242090E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

PPM2C, [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, 242090E7, EC:3.1.3.43, PDP 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMDA-MB-231 cells, PC-3 cells, U-87 MG cells, mouse skeletal muscle tissue, mouse heart tissue
Positive IHC detected inmouse skeletal muscle tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84612-3-RR targets PDP1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15453

Product name: Recombinant human PPM2C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-154 aa of BC047619

Sequence: MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQA

Predict reactive species
Full Name protein phosphatase 2C, magnesium-dependent, catalytic subunit
Calculated Molecular Weight 537 aa, 61 kDa
Observed Molecular Weight 55-61 kDa
GenBank Accession NumberBC047619
Gene Symbol PDP1
Gene ID (NCBI) 54704
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P0J1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Pyruvate dehydrogenase phosphatase 1 (PDP1), also known as PPM2C, is a key hormone-regulated metabolic enzyme that dephosphorylates and activates pyruvate dehydrogenase (PDH), thereby stimulating the conversion of pyruvate into acetyl-CoA (PMID: 36453802). PDP1 expression is regulated by FLT3-ITD in a context-dependent manner, and that it is centrally involved in the adaptation of AML glucose metabolism to the requirements of proliferation, survival and the therapeutic response to FLT3 inhibition (PMID: 37935978).

Protocols

Product Specific Protocols
IHC protocol for PDP1 antibody 84612-3-RRDownload protocol
WB protocol for PDP1 antibody 84612-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...