• Featured Product
  • KD/KO Validated

PDP1 Recombinant monoclonal antibody, PBS Only (Detector)

PDP1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 84612-3-PBS
Clone No.242090E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

PPM2C, [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 1, mitochondrial, 242090E7, EC:3.1.3.43, PDP 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84612-3-PBS targets PDP1 as part of a matched antibody pair:

MP01450-2: 84612-1-PBS capture and 84612-3-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag15453

Product name: Recombinant human PPM2C protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-154 aa of BC047619

Sequence: MPAPTQLFFPLIRNCELSRIYGTACYCHHKHLCCSSSYIPQSRLRYTPHPAYATFCRPKENWWQYTQGRRYASTPQKFYLTPPQVNSILKANEYSFKVPEFDGKNVSSILGFDSNQLPANAPIEDRRSAATCLQTRGMLLGVFDGHAGCACSQA

Predict reactive species
Full Name protein phosphatase 2C, magnesium-dependent, catalytic subunit
Calculated Molecular Weight 537 aa, 61 kDa
Observed Molecular Weight 55-61 kDa
GenBank Accession NumberBC047619
Gene Symbol PDP1
Gene ID (NCBI) 54704
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P0J1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Pyruvate dehydrogenase phosphatase 1 (PDP1), also known as PPM2C, is a key hormone-regulated metabolic enzyme that dephosphorylates and activates pyruvate dehydrogenase (PDH), thereby stimulating the conversion of pyruvate into acetyl-CoA (PMID: 36453802). PDP1 expression is regulated by FLT3-ITD in a context-dependent manner, and that it is centrally involved in the adaptation of AML glucose metabolism to the requirements of proliferation, survival and the therapeutic response to FLT3 inhibition (PMID: 37935978).

Loading...
||
New chat Able
正在加载,请稍候...