PPP1R12B Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PPP1R12B Recombinant monoclonal antibody (87808-1-RR)

• 

  WB analysis using 87808-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87808-1-RR (PPP1R12B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of NIH/3T3 using 87808-1-RR

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using PPP1R12B antibody (87808-1-RR, Clone: 253416D1 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• 

  Affinity of 87808-1-RR

  Biolayer interferometry (BLI) kinetic assays of 87808-1-RR against Human PPP1R12B were performed. The affinity constant is 0.905 nM.

PPP1R12B Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 87808-1-RR

Clone No.253416D1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Myosin phosphatase-targeting subunit 2, MYPT2

---

Tested Applications

• Positive WB detected in: mouse heart tissue, rat heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: NIH/3T3 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87808-1-RR targets PPP1R12B in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4185

  Product name: Recombinant human PPP1R12B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-386 aa of BC034430

  Sequence: MAELEHLGGKRAESARMRRAEQLRRWRGSLTEQEPAERRGAGRQPLTRRGSPRVRFEDGAVFLAACSSGDTDEVRKLLARGADINTVNVDGLTALHQACIDENLDMVKFLVENRANVNQQDNEGWTPLHAAASCGYLNIAEYFINHGASVGIVNSEGEVPSDLAEEPAMKDLLLEQVKKQGVDLEQSRKEEEQQMLQDARQWLNSGKIEDVRQARSGATALHVAAAKGYSEVLRLLIQAGYELNVQDYDGWTPLHAAAHWGVKEACSILAEALCDMDIRNKLGQTPFDVADEGLVEHLELLQKKQNVLRSEKETRNKLIESDLNSKIQSGFFKNKEKMLYEEETPKSQEMEEENKESSSSSSEEEEGEDEASESETEKEAVLFWPF

• Full Name: protein phosphatase 1, regulatory (inhibitor) subunit 12B
• Calculated Molecular Weight: 982 aa, 110 kDa
• Observed Molecular Weight: 110-130 kDa
• GenBank Accession Number: BC034430
• Gene Symbol: PPP1R12B
• Gene ID (NCBI): 4660
• RRID: AB_3745761
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60237
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP1R12B (MYPT2) is a critical regulatory subunit of protein phosphatase 1, primarily functioning in muscle tissues to control myosin phosphatase activity and calcium sensitivity of contraction. Its tissue-specific expression, particularly enrichment in heart and skeletal muscle, along with multiple alternatively spliced isoforms, enables specialized roles in different cellular contexts. The protein's ankyrin repeats and C-terminal kinase-interacting domain facilitate its function as a molecular scaffold that directs PP1 catalytic activity toward specific substrates.