PPP2R2A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PPP2R2A Polyclonal antibody, PBS Only (16569-1-PBS)

• 

  WB analysis using 16569-1-AP (same clone as 16569-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16569-1-AP (PPP2R2A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16569-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16569-1-AP (same clone as 16569-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16569-1-AP (PPP2R2A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16569-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16569-1-AP (same clone as 16569-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16569-1-AP (PPP2R2A antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16569-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 16569-1-AP (same clone as 16569-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16569-1-AP (PPP2R2A antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16569-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 16569-1-AP (same clone as 16569-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using PPP2R2A antibody (16569-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16569-1-PBS in a different storage buffer formulation.

PPP2R2A Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16569-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16569-1-PBS targets PPP2R2A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9851

  Product name: Recombinant human PPP2R2A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 99-447 aa of BC041071

  Sequence: IRWLPQKNAAQFLLSTNDKTIKLWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHINSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCNTFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTGSYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENIIAVATTNNLYIFQDKVN

• Full Name: protein phosphatase 2 (formerly 2A), regulatory subunit B, alpha isoform
• Calculated Molecular Weight: 477 aa, 52 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC041071
• Gene Symbol: PPP2R2A
• Gene ID (NCBI): 5520
• RRID: AB_2878280
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63151
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The serine/threonine protein phosphatase 2A (PP2A) is a master regulator of the complex cellular signaling that occurs during all stages of mammalian development. PPP2R2A, also known as B55A or PR55A, is a regulatory subunit of PP2A expressed in an Akt-dependent manner in epidermis during barrier formation. PPP2R2A participates in the negative control of cell growth and division. PPP2R2A has been proved to be a tumor suppressor that can inhibit the proliferation of a variety of cancer cells, such as prostate cancer cells(PMID: 21872824).