Tested Applications
| Positive WB detected in | mouse brain tissue, Neuro-2a cells |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse cerebellum tissue |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
22589-1-AP targets PRICKLE1 in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18407 Product name: Recombinant human PRICKLE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 321-580 aa of BC114939 Sequence: AFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLLKFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNM Predict reactive species |
| Full Name | prickle homolog 1 (Drosophila) |
| Calculated Molecular Weight | 831 aa, 94 kDa |
| Observed Molecular Weight | 94 kDa, 55-60 kDa |
| GenBank Accession Number | BC114939 |
| Gene Symbol | PRICKLE1 |
| Gene ID (NCBI) | 144165 |
| RRID | AB_2879129 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | Q96MT3 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PRICKLE1, also known as RILP, EPM1B, encodes a cytoplasmic protein with an N-terminal PET (Pk, Espinas, Testin) domain, three LIM domains and a C-terminal PKH (prickle homologous) domain. PRICKLE1 is expressed at the highest levels in placenta and lower levels in lung, liver, kidney and pancreas(PMID: 12525887). PRICKLE1 localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST/NRSF and REST4. Mutations in PRICKLE1 have been linked to progressive myoclonus epilepsy(PMID: 18976727).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PRICKLE1 antibody 22589-1-AP | Download protocol |
| IF protocol for PRICKLE1 antibody 22589-1-AP | Download protocol |
| IHC protocol for PRICKLE1 antibody 22589-1-AP | Download protocol |
| IP protocol for PRICKLE1 antibody 22589-1-AP | Download protocol |
| WB protocol for PRICKLE1 antibody 22589-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-PRICKLE1 antibody (Cat# 22589-1-AP) has 15 citations across journals including Nature Communications, Science Advances, Journal of Biological Chemistry, Development, eLife, and others. Research fields span Planar Cell Polarity (PCP) signaling, Wnt pathway, neural tube morphogenesis, synapse formation, acute myeloid leukemia, myelin sheath development, Sertoli cell function, axon regeneration, epilepsy/autism, leiomyoma pathophysiology, feather branching, midline patterning, and adrenal aldosterone production. Applications include WB, IF, IP, and CoIP across human, mouse, rat, and chicken species.
| Species | Application | Title |
|---|---|---|
Nat Commun Quantitative live imaging reveals PRICKLE1 controls junctional neural tube morphogenesis independent of Planar Cell Polarity. | ||
Sci Adv Prickle promotes the formation and maintenance of glutamatergic synapses by stabilizing the intercellular planar cell polarity complex.
| ||
J Transl Med PRICKLE1, a Wnt/PCP signaling component, is overexpressed and associated with inferior prognosis in acute myeloid leukemia. | ||
Glia The formation of paranodal spirals at the ends of CNS myelin sheaths requires the planar polarity protein Vangl2. | ||
Am J Physiol Cell Physiol PCP protein Prickle 1 regulates Sertoli cell and testis function via cytoskeletal organization through the recruitment of multiple regulatory proteins | ||
Mol Med Rep Regulation of nuclear transport of the transcriptional factor REST improves axon regeneration in peripheral nerves. |
Reviews
What customers say
The single review for this antibody is a 5-star rating from an immunofluorescence application. The user employed a 1:200 dilution and expressed a clear recommendation for IF use, indicating satisfaction with the product's performance in that setting.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Murali (Verified Customer) (10-31-2022) | I will recommend this antibody for IF.
 |
