• Featured Product
  • KD/KO Validated

PRICKLE1 Polyclonal antibody

PRICKLE1 Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA
Cat No. 22589-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA

EPM1B, Prickle-like protein 1, REST/NRSF-interacting LIM domain protein 1, RILP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, Neuro-2a cells
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse cerebellum tissue
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22589-1-AP targets PRICKLE1 in WB, IHC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, chicken
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18407

Product name: Recombinant human PRICKLE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-580 aa of BC114939

Sequence: AFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLLKFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNM

Predict reactive species
Full Name prickle homolog 1 (Drosophila)
Calculated Molecular Weight 831 aa, 94 kDa
Observed Molecular Weight 94 kDa, 55-60 kDa
GenBank Accession NumberBC114939
Gene Symbol PRICKLE1
Gene ID (NCBI) 144165
RRIDAB_2879129
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDQ96MT3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRICKLE1, also known as RILP, EPM1B, encodes a cytoplasmic protein with an N-terminal PET (Pk, Espinas, Testin) domain, three LIM domains and a C-terminal PKH (prickle homologous) domain. PRICKLE1 is expressed at the highest levels in placenta and lower levels in lung, liver, kidney and pancreas(PMID: 12525887). PRICKLE1 localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST/NRSF and REST4. Mutations in PRICKLE1 have been linked to progressive myoclonus epilepsy(PMID: 18976727).

Protocols

Product Specific Protocols
WB protocol for PRICKLE1 antibody 22589-1-APDownload protocol
IHC protocol for PRICKLE1 antibody 22589-1-APDownload protocol
IF protocol for PRICKLE1 antibody 22589-1-APDownload protocol
IP protocol for PRICKLE1 antibody 22589-1-APDownload protocol
FC protocol for PRICKLE1 antibody 22589-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Sci Adv

Prickle promotes the formation and maintenance of glutamatergic synapses by stabilizing the intercellular planar cell polarity complex.

Authors - Yue Ban
  • KO Validated
chickenWB

Development

Coupling of apical-basal polarity and PCP to interpret the Wnt signaling gradient and orient feather branch.

Authors - Jianqiong Lin

Glia

The formation of paranodal spirals at the ends of CNS myelin sheaths requires the planar polarity protein Vangl2.

Authors - Andrew A Jarjour
mouseWB

Exp Neurol

Mutation of the murine Prickle1 (R104Q) causes phenotypes analogous to human symptoms of epilepsy and autism.

Authors - Yue Ban
humanWB

J Transl Med

PRICKLE1, a Wnt/PCP signaling component, is overexpressed and associated with inferior prognosis in acute myeloid leukemia.

Authors - Duanfeng Jiang
IF

bioRxiv

Differential Sensitivity of Midline Patterning to Mitosis during and after Primitive Streak Extension

Authors - Zhiling Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Murali (Verified Customer) (10-31-2022)

I will recommend this antibody for IF.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1 to 200
PRICKLE1 Antibody Immunofluorescence validation (1 to 200 dilution) in (Cat no:22589-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...