• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated PRICKLE1 Polyclonal antibody

PRICKLE1 Polyclonal Antibody for FC (Intra)
Cat No. CL488-22589

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

FC (Intra)

EPM1B, prickle homolog 1 (Drosophila), Prickle like protein 1, PRICKLE1, RILP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHeLa cells
Positive FC detected inHeLa cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-22589 targets PRICKLE1 in FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18407

Product name: Recombinant human PRICKLE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-580 aa of BC114939

Sequence: AFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLLKFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNM

Predict reactive species
Full Name prickle homolog 1 (Drosophila)
Calculated Molecular Weight 831 aa, 94 kDa
Observed Molecular Weight 94 kDa, 55-60 kDa
GenBank Accession NumberBC114939
Gene Symbol PRICKLE1
Gene ID (NCBI) 144165
RRIDAB_3672746
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96MT3
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PRICKLE1, also known as RILP, EPM1B, encodes a cytoplasmic protein with an N-terminal PET (Pk, Espinas, Testin) domain, three LIM domains and a C-terminal PKH (prickle homologous) domain. PRICKLE1 is expressed at the highest levels in placenta and lower levels in lung, liver, kidney and pancreas(PMID: 12525887). PRICKLE1 localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST/NRSF and REST4. Mutations in PRICKLE1 have been linked to progressive myoclonus epilepsy(PMID: 18976727).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PRICKLE1 antibody CL488-22589Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...