PRICKLE1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  WB analysis of MDA-MB-231 using 84926-1-RR (same clone as 84926-1-PBS)

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 84926-1-RR (PRICKLE1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84926-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 84926-1-RR (same clone as 84926-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 84926-1-RR (PRICKLE1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84926-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP01670-2

  Cytometric bead array standard curve of MP01670-2, PRICKLE1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84926-3-PBS. Detection antibody: 84926-1-PBS. Standard: Ag18407. Range: 0.156-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 84926-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84926-1-RR against Human PRICKLE1 were performed. The affinity constant is 7.50 nM.

PRICKLE1 Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 84926-1-PBS

Clone No.242506A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

242506A8, EPM1B, Prickle-like protein 1, REST/NRSF-interacting LIM domain protein 1, RILP

---

Product Information

84926-1-PBS targets PRICKLE1 as part of a matched antibody pair:

MP01670-2: 84926-3-PBS capture and 84926-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag18407

  Product name: Recombinant human PRICKLE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 321-580 aa of BC114939

  Sequence: AFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLLKFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNM

• Full Name: prickle homolog 1 (Drosophila)
• Calculated Molecular Weight: 831 aa, 94 kDa
• Observed Molecular Weight: 94 kDa
• GenBank Accession Number: BC114939
• Gene Symbol: PRICKLE1
• Gene ID (NCBI): 144165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96MT3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PRICKLE1, also known as RILP, EPM1B, encodes a cytoplasmic protein with an N-terminal PET (Pk, Espinas, Testin) domain, three LIM domains and a C-terminal PKH (prickle homologous) domain. PRICKLE1 is expressed at the highest levels in placenta and lower levels in lung, liver, kidney and pancreas(PMID: 12525887). PRICKLE1 localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST/NRSF and REST4. Mutations in PRICKLE1 have been linked to progressive myoclonus epilepsy(PMID: 18976727).