PRICKLE1 Recombinant monoclonal antibody, PBS Only (Detector)

PRICKLE1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 84926-1-PBS
Clone No.242506A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

242506A8, EPM1B, Prickle-like protein 1, REST/NRSF-interacting LIM domain protein 1, RILP

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84926-1-PBS targets PRICKLE1 as part of a matched antibody pair:

MP01670-2: 84926-3-PBS capture and 84926-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag18407

Product name: Recombinant human PRICKLE1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 321-580 aa of BC114939

Sequence: AFQSARSRDSRRSVRMGKSSRSADQCRQSLLLSPALNYKFPGLSGNADDTLSRKLDDLSLSRQGTSFASEEFWKGRVEQETPEDPEEWADHEDYMTQLLLKFGDKSLFQPQPNEMDIRASEHWISDNMVKSKTELKQNNQSLASKKYQSDMYWAQSQDGLGDSAYGSHPGPASSRRLQELELDHGASGYNHDETQWYEDSLECLSDLKPEQSVRDSMDSLALSNITGASVDGENKPRPSLYSLQNFEEMETEDCEKMSNM

Predict reactive species
Full Name prickle homolog 1 (Drosophila)
Calculated Molecular Weight 831 aa, 94 kDa
Observed Molecular Weight 94 kDa
GenBank Accession NumberBC114939
Gene Symbol PRICKLE1
Gene ID (NCBI) 144165
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96MT3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PRICKLE1, also known as RILP, EPM1B, encodes a cytoplasmic protein with an N-terminal PET (Pk, Espinas, Testin) domain, three LIM domains and a C-terminal PKH (prickle homologous) domain. PRICKLE1 is expressed at the highest levels in placenta and lower levels in lung, liver, kidney and pancreas(PMID: 12525887). PRICKLE1 localizes to the nuclear membrane and has been implicated in the nuclear trafficking of the transcription repressors REST/NRSF and REST4. Mutations in PRICKLE1 have been linked to progressive myoclonus epilepsy(PMID: 18976727).

Loading...
||
New chat Able
正在加载,请稍候...