CoraLite®594-conjugated PRMT2 Monoclonal antibody

• 

  IF Staining of HeLa using CL594-66885

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using CoraLite®594 PRMT2 antibody (CL594-66885, Clone: 1F1B9 ) at dilution of 1:200.

PRMT2 Monoclonal Antibody for IF/ICC

Cat No. CL594-66885

Clone No.1F1B9

Host / Isotype

Mouse / IgG2a

Reactivity

Human, mouse, rat

Applications

IF/ICC

Synonyms

HMT1, HRMT1L1, PRMT2

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66885 targets PRMT2 in IF/ICC applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1806

  Product name: Recombinant human PRMT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 134-433 aa of BC000727

  Sequence: ESLTDKVILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLAVKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSLQEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPTSQKVGEKVFPIWR

• Full Name: protein arginine methyltransferase 2
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC000727
• Gene Symbol: PRMT2
• Gene ID (NCBI): 3275
• RRID: AB_3084733
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55345
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PRMT2 (also known as HRMT1L1) is a member of the arginine methyltransferase family which catalyzes arginine methylation and regulates diverse cellular processes, including transcription, translation, DNA repair, and RNA processing. Recently PRMT2 has been identified as a pro-tumorigenic factor in malignant gliomas.