PRPF18 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRPF18 Polyclonal antibody, PBS Only (10261-1-PBS)

• 

  WB analysis using 10261-1-AP (same clone as 10261-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10261-1-AP (PRPF18 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10261-1-PBS in a different storage buffer formulation.

PRPF18 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 10261-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

hPRP18, Pre-mRNA-splicing factor 18, PRP18, PRPF 18

---

Product Information

10261-1-PBS targets PRPF18 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0329

  Product name: Recombinant human PRPF18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-47 aa of BC002572

  Sequence: MDILKSEILRKRQLVEDRNLLREYVKANDAYLQMAIGNAPWPIGVTM

• Full Name: PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae)
• Calculated Molecular Weight: 5 aa, 475 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC002572
• Gene Symbol: PRPF18
• Gene ID (NCBI): 8559
• RRID: AB_3741814
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99633
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.