CoraLite® Plus 488-conjugated PRPSAP2 Polyclonal antibody

PRPSAP2 Polyclonal Antibody for IF/ICC
Cat No. CL488-17814

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

PRPP synthase-associated protein 2, Phosphoribosyl pyrophosphate synthase-associated protein 2, PAP41, 41 kDa phosphoribosypyrophosphate synthetase-associated protein

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inBxPC-3 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17814 targets PRPSAP2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12132

Product name: Recombinant human PRPSAP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-369 aa of BC106050

Sequence: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD

Predict reactive species
Full Name phosphoribosyl pyrophosphate synthetase-associated protein 2
Calculated Molecular Weight 369 aa, 41 kDa
Observed Molecular Weight 37-41 kDa
GenBank Accession NumberBC106050
Gene Symbol PRPSAP2
Gene ID (NCBI) 5636
RRIDAB_3672682
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60256
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

PRPSAP2, also named as PAP41, is 369 amino acid protein, which Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis. PRPSAP2 is another protein involved in nucleic acid metabolism. The PRPSAP2 gene encodes part of the enzyme PRPP synthetase, which catalyzes the formation of phosphoribosylpyrophosphate, being a primary substrate for newly formed purine and pyrimidine nucleotides. Depletion of the PRPP synthetase causes growth arrest], the reverse has not been shown. Overexpression of SHMT1 and PRPSAP2 (and also COPS3) has been reported to occur in multiple myelomas . PRPSAP2 exists several isoforms with the range of molecular weight about 35-43 kDa.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 PRPSAP2 antibody CL488-17814Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...