CoraLite® Plus 488-conjugated PRPSAP2 Polyclonal antibody

• 

  IF Staining of BxPC-3 using CL488-17814

  Immunofluorescent analysis of (-20°C Ethanol) fixed BxPC-3 cells using CoraLite® Plus 488 PRPSAP2 antibody (CL488-17814) at dilution of 1:200.

PRPSAP2 Polyclonal Antibody for IF/ICC

Cat No. CL488-17814

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

PRPP synthase-associated protein 2, Phosphoribosyl pyrophosphate synthase-associated protein 2, PAP41, 41 kDa phosphoribosypyrophosphate synthetase-associated protein

---

Tested Applications

• Positive IF/ICC detected in: BxPC-3 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-17814 targets PRPSAP2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12132

  Product name: Recombinant human PRPSAP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-369 aa of BC106050

  Sequence: MFCVTPPELETKMNITKGGLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQGFFNIPVDNLRASPFLLQYIQEEIPDYRNAVIVAKSPASAKRAQSFAERLRLGIAVIHGEAQDAESDLVDGRHSPPMVRSVAAIHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVMATHGLLSSDAPRRIEESAIDEVVVTNTIPHEVQKLQCPKIKTVDISMILSEAIRRIHNGESMSYLFRNIGLDD

• Full Name: phosphoribosyl pyrophosphate synthetase-associated protein 2
• Calculated Molecular Weight: 369 aa, 41 kDa
• Observed Molecular Weight: 37-41 kDa
• GenBank Accession Number: BC106050
• Gene Symbol: PRPSAP2
• Gene ID (NCBI): 5636
• RRID: AB_3672682
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60256
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

PRPSAP2, also named as PAP41, is 369 amino acid protein, which Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis. PRPSAP2 is another protein involved in nucleic acid metabolism. The PRPSAP2 gene encodes part of the enzyme PRPP synthetase, which catalyzes the formation of phosphoribosylpyrophosphate, being a primary substrate for newly formed purine and pyrimidine nucleotides. Depletion of the PRPP synthetase causes growth arrest], the reverse has not been shown. Overexpression of SHMT1 and PRPSAP2 (and also COPS3) has been reported to occur in multiple myelomas . PRPSAP2 exists several isoforms with the range of molecular weight about 35-43 kDa.