PRSS8 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PRSS8 Polyclonal antibody, PBS Only (15527-1-PBS)

• 

  WB analysis of mouse kidney using 15527-1-AP (same clone as 15527-1-PBS)

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 15527-1-AP (PRSS8 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 15527-1-AP (same clone as 15527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 15527-1-AP (PRSS8 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 15527-1-AP (same clone as 15527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15527-1-AP (PRSS8 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 15527-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary tumor using 15527-1-AP (same clone as 15527-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15527-1-AP (PRSS8 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 15527-1-PBS in a different storage buffer formulation.

PRSS8 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 15527-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, Indirect ELISA

Synonyms

CAP1, Channel-activating protease 1, EC:3.4.21.-, Prostasin heavy chain, Prostasin light chain

---

Product Information

15527-1-PBS targets PRSS8 in IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7234

  Product name: Recombinant human PRSS8 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-325 aa of BC001462

  Sequence: SGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPIL

• Full Name: protease, serine, 8
• Calculated Molecular Weight: 36 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC001462
• Gene Symbol: PRSS8
• Gene ID (NCBI): 5652
• RRID: AB_2172168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16651
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Protease serine S1 family member 8 (PRSS8), a membrane-anchored serine protease, has been reported to be involved in the development of several human cancers. PRSS8 protein level was highly expressed in well differentiated cancer cell and was lower or absent in poorly differentiated cancer cell. Significantly higher levels of prostasin were found in early stage OVC serum samples compared to benign ovarian and normal donor samples. Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of OVC. (PMID: 27036110, PMID: 27050145)